KEGG   Gardnerella vaginalis 409-05: HMPREF0424_1019Help
Entry
HMPREF0424_1019   CDS       T01146                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
gva  Gardnerella vaginalis 409-05
Pathway
gva00260  Glycine, serine and threonine metabolism
gva00750  Vitamin B6 metabolism
gva01100  Metabolic pathways
gva01110  Biosynthesis of secondary metabolites
gva01120  Microbial metabolism in diverse environments
gva01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gva00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF0424_1019 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HMPREF0424_1019 (thrC)
Enzymes [BR:gva01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HMPREF0424_1019 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: ADB13654
UniProt: D2RBP0
Position
1148957..1150483
Genome map
AA seq 508 aa AA seqDB search
MAADTTIFHSTRSLKPTCTSKEAIRKGIAEDGGLFVADSLGSERYDISKLQGKSYQEIAQ
DILQLLLPDYTSEELSSCIKLAYGNQWANNAITPLQQLGNTSDFVMELFHGPTCAFKDVA
LQMLPQLMSRTKTQHENESDIEKSVMILTATSGDTGKAALAGFADVPGTSMVTFYPEGKV
SRVQELQMTTQVGENVKVCAVRGNFDDAQTGVKQIFTNSELNKNIEESANTELSSANSIN
VGRLVPQVVYYFAAYKQLVERKAIALGDEIEFCVPTGNFGDILAGYYAKMLGLPVKHLIV
ASNSNNVLFDFLVSGTYNRQRTFHHTVAPSMDILVSSNLERMLYYMCDKDTRLIQMLMND
LQQWGAFEIPENVLAKIRSLFGCGWANEDQIREAIYDCWNKYKYVIDPHTACGFFVMQNI
PHDESTPRVLLSTASPYKFPRVVAEALNIEHVQDMNDFKCMDALSKATGTKAPSMLRNLE
NKTPRFNDVINVEDMPEYVLAQAHNFAK
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagatacaactattttccatagcactcgttcgcttaagccaacatgcacatca
aaagaggcaatacgtaaaggaattgctgaagatggcggattatttgtagctgatagcctt
ggtagcgaacgttacgatatttctaaattgcaaggcaaatcgtatcaagaaattgcgcag
gatattttgcaactgttgctgcctgattatacttcagaagagctttcttcttgcattaaa
ctggcatacggcaatcaatgggctaataacgctattactccacttcagcagcttggaaac
actagcgattttgttatggaacttttccatggtcctacttgcgcgtttaaagacgttgct
ttgcaaatgttgccacaattaatgtctcgcactaaaactcaacacgagaacgaatctgat
attgaaaaaagcgttatgattctaactgcaacttctggagatacaggtaaagctgctttg
gctggttttgctgatgttccaggcacttctatggttactttttatccagaaggaaaagtt
agccgcgttcaagaattgcaaatgactacgcaggtgggcgaaaatgtgaaagtttgcgca
gttcgaggcaattttgacgatgctcaaactggcgtaaaacagattttcaccaatagtgag
cttaataaaaatattgaagaatctgcgaatactgaattgtcttctgctaattcaataaat
gttggacgactcgtgccgcaagtcgtgtactattttgcggcttataagcaacttgttgag
cgtaaagcaatagctcttggagacgaaattgagttttgcgtaccaaccggcaattttggc
gatattcttgctggatattacgcaaaaatgcttggtcttcctgtaaaacatcttattgtt
gcaagcaatagcaataatgttttgtttgattttttggtaagcggcacttataaccgtcag
cgcacattccatcacactgttgctccttctatggatattttggtttcttctaatttggaa
cgaatgctttattacatgtgcgataaagacacgcgtttaatacaaatgcttatgaacgat
ttacagcagtggggcgcttttgagattccagaaaatgtgcttgcaaagattcgctcactg
tttggctgcggttgggcaaatgaagatcaaattcgcgaagctatttatgactgctggaac
aagtacaagtatgtaatcgacccacatactgcttgcggattcttcgttatgcaaaatatt
ccacatgacgaaagcacacctagagtattgctaagcactgcaagcccatacaaattccct
cgcgttgttgctgaagctttgaatattgagcatgtgcaagatatgaatgatttcaaatgc
atggacgctcttagtaaagctacaggaactaaagctccaagcatgcttagaaatcttgaa
aataaaactccacgctttaatgatgttattaatgttgaagatatgcctgagtatgtttta
gctcaagcgcataatttcgcaaaataa

DBGET integrated database retrieval system