KEGG   Gardnerella vaginalis HMP9231: HMPREF9231_0053Help
Entry
HMPREF9231_0053   CDS       T01939                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
gvh  Gardnerella vaginalis HMP9231
Pathway
gvh00010  Glycolysis / Gluconeogenesis
gvh00052  Galactose metabolism
gvh00500  Starch and sucrose metabolism
gvh00520  Amino sugar and nucleotide sugar metabolism
gvh00521  Streptomycin biosynthesis
gvh01100  Metabolic pathways
gvh01110  Biosynthesis of secondary metabolites
gvh01120  Microbial metabolism in diverse environments
gvh01130  Biosynthesis of antibiotics
gvh01200  Carbon metabolism
Module
gvh_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gvh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF9231_0053
   00052 Galactose metabolism
    HMPREF9231_0053
   00500 Starch and sucrose metabolism
    HMPREF9231_0053
   00520 Amino sugar and nucleotide sugar metabolism
    HMPREF9231_0053
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HMPREF9231_0053
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    HMPREF9231_0053
Enzymes [BR:gvh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HMPREF9231_0053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AEF31110
Position
57858..58859
Genome map
AA seq 333 aa AA seqDB search
MNETKDSRPTYLAFDIGGTKIAYGLVTLPDSNIRQENADYVSPTVQEHGSMPTEAAKGGE
NIKNRLVEKVSQIIEEAQKNGKTISGIGIAAAGVPNSKTGEIVAATDILPGWRGQRIYDA
FKSVTDLPVYMIGDVGGHGLGEAIYGAGRGKSIVFSVGIGTGIGGAIIINGKLFTGAHGV
AGHAGHVVSDLGVGFDCSCGARAGHIEPVASGTGLATLYNRNLPAGTQEAQNGYDVCVRA
NSGEEYAKEILARSGKALGECVAGMANLIDPDVIVLSGSVVEAGDIWWNAMRSGFEDSAL
TLIKNTPILKGQLGGSAPLIGAAWAVHLSLNHF
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaacaaaagattctcgccctacatatcttgcttttgacataggtggaacaaaa
attgcctatggattggtgactttgccagattctaatattcgccaagaaaatgcagattac
gtatctccaacagtgcaagagcatggttcaatgccaacagaagctgcaaaaggtggagaa
aatataaagaatcgcctagtggaaaaagtgtcgcaaatcatagaagaagcgcagaaaaat
ggcaaaactattagcggaattggaatagcggctgcgggagtgccaaatagtaaaactggc
gaaattgtagctgctacagacattctgccaggttggcgaggacagcgaatttatgacgca
tttaagagcgtaactgacttgccagtttatatgattggcgatgttggtggacatggttta
ggcgaagcaatttacggcgcgggtcgcggaaagtcgattgtattttctgttggcataggc
actggaattggtggggcgattattataaatggtaagctgtttacaggagcgcacggagtt
gctgggcatgcgggtcacgttgttagtgacttgggagtaggttttgactgctcgtgcgga
gcgcgtgcgggccacattgagccagtggcttctggaacggggcttgcgactctttacaat
cgaaatcttccagctggtactcaagaagcccaaaatggttatgatgtttgcgtaagagca
aattctggtgaggaatatgcaaaagaaattcttgctagaagcggtaaggctttgggtgag
tgcgtagctggaatggctaatcttatagatccagatgtgattgtgctttctgggtctgtt
gtagaagctggtgatatttggtggaatgctatgcgaagtggatttgaagattctgctttg
acattgattaagaacaccccaattttaaagggtcaacttggaggatctgctcctctgatt
ggcgctgcttgggctgttcatttaagtttgaaccatttttaa

DBGET integrated database retrieval system