KEGG   Gloeobacter violaceus: gll1167Help
Entry
gll1167           CDS       T00148                                 

Definition
(RefSeq) glucose dehydrogenase
  KO
K22969  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
gvi  Gloeobacter violaceus
Pathway
gvi00030  Pentose phosphate pathway
gvi01100  Metabolic pathways
gvi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gvi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    gll1167
Enzymes [BR:gvi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     gll1167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu_dehyd_C ADH_N ADH_zinc_N Shikimate_DH Pyr_redox_2
Motif
Other DBs
NCBI-GeneID: 2598933
NCBI-ProteinID: NP_924113
CYORF: gll1167
UniProt: Q7NLF7
Position
complement(1242005..1243111)
Genome map
AA seq 368 aa AA seqDB search
MKAIAVFPGQPNSIHLANLPKPGVDDVPGGRGVLVKILCVGVDGTDKEINAAEYGTAPPG
YDFLVIGHESFGVVEAVGSQVTELSVGDVVVATVRRPGSSIYDRIGQYDMTLDDTYYERG
ISLRHGFLTEYYVDEPEYIVKVPPGLKATGVLLEPASVIEKGIHQAYEIQRRLRVWQPKR
AAVLGAGTIGLLATLALRLRGLEVCTFARTRPPYLNSELVEQIGGCYHSSQDLSLAEASK
AHGPFDLIFEATGFAPLVFEAMNILGKNGVLVLSSVTGGGRNIEIPADRINLGFVLGNKV
VVGTVNANREYFELGVRDFCLAEMQYPGWLAKLLTHPVEGLENYQELIDTLTEAKGAIKV
FCEIAPIV
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgatcgctgtttttcccggtcaacccaacagcatccacctcgccaacctgccc
aagccgggcgtggacgatgtcccaggcggccggggcgtcctggtcaagattctgtgcgtc
ggcgtggacggcaccgacaaagagatcaacgccgccgaatacgggacggctccgcccggc
tacgattttctggtgatcgggcacgagagcttcggcgtcgtcgaagccgtcggatcgcag
gtcaccgaactatccgtcggcgatgtcgtcgtcgccacggtgcgccggccgggcagcagc
atctacgaccggatcggccagtacgacatgaccctcgacgacacctactacgagcgcggc
atcagcctccgccacggctttctcaccgagtactacgtcgacgagcccgagtacatcgtc
aaagtgcccccgggactgaaggcgaccggggtattgctcgaacccgccagcgtcatcgaa
aagggcatccaccaagcctacgagatccagcggcggttgcgggtctggcagccgaagcgg
gcggcggtgctcggggcgggcacgatcgggctgcttgccaccctggcactgcgcctgagg
ggactggaagtgtgtaccttcgcccgcacccgcccgccttatctcaactcggaactcgtc
gaacaaatcggcggctgctaccacagcagccaggatctaagcctggcggaagcctcgaag
gcgcacggccccttcgacctcatcttcgaggcgaccggctttgctccgctggtctttgag
gcgatgaacatcctcggcaaaaacggcgtgctcgttttgtcgagcgtgacgggcggcggg
cgcaacatcgagatcccggccgaccggatcaacctgggttttgtgctgggcaacaaagtc
gtcgtcggcacggtcaatgccaaccgcgagtactttgaactgggcgtccgggacttttgt
ctcgccgaaatgcagtatcccggctggcttgcgaagctgctcacccacccggtcgagggc
ctggagaactaccaggagttgatcgacaccctgaccgaggcaaaaggagcaatcaaagtc
ttttgcgagatcgctcctattgtctag

DBGET integrated database retrieval system