KEGG   Gloeobacter violaceus: gll1854Help
Entry
gll1854           CDS       T00148                                 

Definition
(RefSeq) two-component sensor histidine kinase
  KO
K13924  two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
gvi  Gloeobacter violaceus
Pathway
gvi02020  Two-component system
gvi02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:gvi00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    gll1854
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    gll1854
Enzymes [BR:gvi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     gll1854
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     gll1854
Two-component system [BR:gvi02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   gll1854
Bacterial motility proteins [BR:gvi02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    gll1854
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest CheR HATPase_c PAS_10 PAS_4 HisKA CheR_N PAS PAS_9 IncA Methyltransf_12 Methyltransf_23 Methyltransf_31 PAS_8 PAS_7 Methyltransf_25 Golgin_A5 Fez1 BLOC1S3 Methyltransf_11 APG6 AAA_23 HATPase_c_2 Exonuc_VII_L Med21 Spc7 HMMR_N AAA_13 DUF812 WEMBL HOOK
Motif
Other DBs
NCBI-GeneID: 2600256
NCBI-ProteinID: NP_924800
CYORF: gll1854
UniProt: Q7NJH8
Position
complement(1972641..1976366)
Genome map
AA seq 1241 aa AA seqDB search
MAIDSGGGADSFSLSLGSFAIVAVGASAGGLEAFTQFLGALPTDTGMAFVLIQHLKADQP
SLLVEILDKTTGMDVVQVHNGTVVEPNHVYVIPPDRQMAITSGVLTLSQRRKTDGQFMPI
DSFFHSLAADWGNRAIGVVLSGADGDGAQGLKAIKAAGGLAFAQDEQSARFPSMPHNAAA
TGLLDFVLPPREIAVRLAAVGRHPYIAPPAATAPPTPPGAEEARSAAIALLRAATGVDFG
QYKRPTFERRLQRRMALHQIESPQEFVRHLQDHPEEVQALYRDVLISVTGFFRDPEAFEA
VKNTVLSAITQQRAEGLPIRVWVPGCATGEEVYSLAIGVLEFLEEHPSPTPVQFFGTDIS
EEAIALARTGLYHASQIEGLSPERLRRFFSQGEGGHRVCKRVRELCVFARHDLLADPPFS
QMDLVSCRNVLIYFSLPAQKRVLTTFHYSLKPDGFLLLGTSESPGGASELFNRVDSKNKL
FSRKAVPARLLLEYAAGPVAADPLNPKQPAAGGAGNAPDLQKEADRLVLDRYAPVGVVVG
ADAEVLHFRGQTGPYLQPSPGRASLNLLKMVHPGLRSQLRSALQLAAKQSLAQCQQDIRL
YDGDRERRVRIDVAPFRSASGQTHFLVLFADTPMVEVSAPLPGPRSAAADRQSAQQQRLL
ELQQELTAKEEYLRTAIEESEAVNQNLRVANEEILSSNEELQSTNEELQTAKEEIQSTNE
ELHTINDELQRRNRELDRLGNDLQNLLASTRLPIVMLDSELRIRRFTPQAGELLHFVSAD
VGRPVRDINHRLSVPDLPERVLEVIASRRIHIQEVQDRGGHWHELCIRPYHTLDGATEGA
VLVLVDIDQSKRAVEEVKAARDYAEAIVETVGEPLIVLDAELSAVTANRAFYELFETHPD
QIEGRSLFEVSGGQWNLPQLREALEGVLQGDGRVQDFEVDRDFERLGRKILLLNARHMPF
YAGGPRQILLSVSDVTARRLLEGERSELLAQSEAARRDAEAANRSKDEFLATLSHELRTP
LNPIIGFSQLLRRGKCDPAQTAQALEVIERCGKLQAQLIDDMLDISRIISGKLHVVMRRI
DLVPVVGAAVEAVDAIGRAKSIRIETVCAPAPPVMADSTRMQQVVWNLLTNAVKFTPEGG
RVGVRLEGTAAGVRLTVSDTGMGIAPEFLPKMFDRFAQGDGSRTRTQGGLGLGLYLVRSL
IELHGGTVDAHSAGEGRGSVFTVALPAAPPQPEHPDRNLGS
NT seq 3726 nt NT seq  +upstreamnt  +downstreamnt
atggcgatagattccggggggggagccgattcattctctttgtcgttaggttcttttgcg
atagttgccgtcggggcctcggcaggggggctcgaagctttcacacagtttttgggtgcc
ttgccaaccgataccggcatggcgttcgtgttgatccagcacctcaaagccgaccagccg
agcttgctggttgagatcctggataaaacaaccggcatggacgttgtccaggtgcacaac
ggcacggtcgtggagccaaaccatgtctacgtgatcccgcccgaccggcagatggcgatt
accagcggcgtgctcaccctctcgcagcgccgcaagaccgacgggcagtttatgcccatc
gactccttttttcattcgctggctgcagactggggcaaccgggcgatcggtgtggtgctt
tcgggagcggacggcgacggtgcgcaagggctcaaggcgatcaaggcggcgggcggcctc
gctttcgcccaggacgagcaatcggcccggtttccgagcatgccccacaatgccgcggca
acagggctgctggattttgtcctgccgccccgggagatcgcggtgcggttggccgcggtc
ggccgtcatccctacatcgcccccccggccgccaccgccccgcccaccccgcccggcgcc
gaggaggccaggagtgccgccatcgcgctgctgcgcgccgccaccggggtggacttcggc
cagtacaagcgcccgacctttgagcggcgcttgcaaaggcgcatggcgctgcaccagatc
gaaagcccgcaggaattcgttcgccaccttcaagaccacccggaggaagtccaggccctg
taccgtgacgtgctcatcagcgtcacgggcttttttcgcgaccccgaagctttcgaggcg
gtgaaaaacactgtcctgtccgccattacccagcagcgggccgagggcctgcccatccgc
gtctgggtgccggggtgcgccacgggcgaggaggtctactcccttgccattggcgtgctg
gagttcctggaggagcacccctccccaacccccgtccagtttttcggcactgacatcagc
gaggaggcaatcgcccttgcccgcactggtctctaccacgcctcccaaatcgagggcctc
tcccccgagcggctgcgacggttctttagccagggcgagggcggccaccgggtctgcaag
cgggtgcgcgaactgtgcgtctttgctcgccacgacctgctcgcggatccgcccttttcc
cagatggatctggtcagttgccgcaacgtgttgatttacttctcgctgcctgcccagaag
cgggtgctcactacctttcactacagcctcaagccggacggctttttgctgttgggcacc
tccgagagcccggggggggcgtccgagctgttcaaccgggtcgattcgaaaaacaaactg
ttctcccgaaaggcggtgcccgcccggctgctcctggagtacgccgccgggcccgttgcg
gcggacccgctcaaccccaaacagcccgccgcgggcggggcggggaacgctcccgatctg
caaaaagaggccgaccggctcgttctggaccggtacgccccggtcggcgtggtcgtgggc
gccgacgcggaggtactgcactttcggggccagaccggtccctatctccagccgtcccct
ggccgtgccagcctcaacctgctcaagatggtgcaccccggcttgcgttcacagctgcgc
tcggcgctgcagctggccgccaagcagtcgcttgcccagtgccagcaagatatccggctc
tacgacggcgatcgggagcggcgggtgcgcatcgacgtcgcccccttcagatccgcctcc
gggcagacccactttctggtgttgtttgccgacaccccgatggtcgaggtgagcgcgccg
cttcccggaccccgttccgccgcggccgacaggcaaagcgcccaacagcaaagactcctg
gaattgcagcaggagttgacggccaaggaggaatacctgcgcacggcgattgaggagtcc
gaagccgtcaaccagaacctccgggtcgccaacgaagagatcctctcaagtaacgaagag
ttgcagagcaccaacgaagaactgcagaccgccaaagaagagatccagtccaccaacgaa
gaactccacacgatcaacgacgaactgcagcggcgcaaccgggaactggaccggctcggc
aacgacctgcagaacctgcttgcgagcacccggcttccgatcgtcatgctcgacagcgag
ctgcggattcggcgctttacgccccaggcgggcgaactgctccattttgtctccgccgac
gtcggccggcccgtgcgcgacatcaaccaccggttgagcgtccccgacctgcccgagcgc
gtcctggaggtgatcgccagccggcgcatccacatccaggaggtgcaggaccggggcggc
cactggcacgaactgtgcatccgcccctaccacaccctggatggcgcgaccgagggcgcg
gtgctggtgctggtggacatcgaccagagcaagcgcgccgtcgaggaggtcaaagccgcc
cgcgactacgcagaagcgatcgtcgagaccgtgggcgaaccgctcatcgtgctcgacgca
gaactgagcgcggtgacggcgaaccgggcgttttacgagcttttcgagacccatcccgac
cagatcgagggccgctcactgttcgaggtaagcggcgggcagtggaacctcccccagttg
cgggaggcgctcgaaggggtgctccagggcgacggccgggtgcaggattttgaggtggac
cgcgacttcgagcggctggggcgcaagatcctgctgctcaacgcccgccacatgccgttc
tacgccggtggcccgcgccagatcttgctttcggtttcggatgtcacggcccggagacta
ctggaaggggaacgctccgaattgctcgcccagagcgaggcggcaaggcgggacgccgag
gcggccaaccgctcgaaggacgaatttctggccaccctcagccacgagttgcgcaccccc
ctcaacccgatcatcggcttctcgcaactgctgcggcgcggcaagtgcgacccggcccag
acggcccaggccctggaggtgatcgagcgctgcggcaagctgcaggcgcaactgatcgac
gacatgctcgatatctcgcggatcatctcgggcaaactacacgtcgtgatgcgccgaatc
gatctggtgccggtggtcggtgccgccgtcgaagcggtcgatgcgatcggccgggccaaa
tcgatccgcatcgagacggtgtgcgccccggccccgccggtgatggccgattccacccgg
atgcagcaggtggtgtggaacctgctcaccaacgccgtcaaattcacccccgaaggcggg
cgggtgggggtgcggctggagggtaccgccgcgggcgtgcgcctgacggtgtccgacacg
ggtatgggcatcgcgccggagttcttaccgaaaatgttcgatcgcttcgcccagggagac
ggctcccgcacccgcacccagggcggactgggattgggcctgtatctggtgcgcagcctg
atcgaactgcacggcggcaccgtcgacgcccacagcgcgggagaaggccggggcagtgtc
ttcaccgtcgcattgcccgccgctccgccgcagcctgaacacccggatcggaacctcggg
tcttga

DBGET integrated database retrieval system