KEGG   Gloeobacter violaceus: gll2424Help
Entry
gll2424           CDS       T00148                                 

Definition
(RefSeq) 5'-methylthioadenosine phosphorylase
  KO
K00772  5'-methylthioadenosine phosphorylase [EC:2.4.2.28]
Organism
gvi  Gloeobacter violaceus
Pathway
gvi00270  Cysteine and methionine metabolism
gvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gvi00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    gll2424
Enzymes [BR:gvi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.28  S-methyl-5'-thioadenosine phosphorylase
     gll2424
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PNP_UDP_1
Motif
Other DBs
NCBI-GeneID: 2600825
NCBI-ProteinID: NP_925370
CYORF: gll2424
UniProt: Q7NHW1
Position
complement(2582082..2582981)
Genome map
AA seq 299 aa AA seqDB search
MSYPQARIGVIGGSGLYQMADLADTVEVQFNTPFGPPSDALVIGTLAGERVAFLPRHGRG
HRLLPAELPFQANIYAMKMLGVEYLLSASAVGSLREEYRPRDIVFPDQFFDRTKDRPSTF
FGGGLVAHIGFDQPICTELAHLAAEAARGVELIGETRIHTGGTYVCMEGPAFSTLAESRL
YRSWGMDIIGMTNLQEAKLAREAEICYATMALVTDYDCWHPDHGAVTVELIIDNLHKNAE
NAQRIVRAVVERLHAAAPPCASHSALKYALLTQPEDVPQATKQKLAAILAKYPAYRPEV
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgagctatccccaggcccgcatcggggtgatcggcggcagcggtctctaccagatggcc
gaccttgccgacaccgtcgaagtgcagttcaacaccccctttggtccaccctccgacgcc
ctggtcatcggcaccctcgcaggcgaacgcgtcgcctttctgccccgccacggccgcggc
caccggcttttgccggccgagttgccctttcaggcgaacatctacgcgatgaagatgctg
ggggtggaatatctcctctccgcctcagcggtaggttcgctgcgcgaggagtaccggccg
cgcgacatcgtctttccggatcagttttttgaccgcaccaaggaccggccctcgactttt
tttggtggcggcctggtggcccacatcggcttcgaccagcccatctgcacggaacttgcc
cacctggcggccgaggcggcgcgcggcgtcgagttgattggcgagacgcgcatccacacc
ggcggcacctacgtgtgcatggaaggaccggccttctcgactttggctgaatcgcggctc
taccgcagctggggcatggacatcatcggcatgactaatctgcaagaggcgaaactcgcc
cgcgaagcggaaatttgctacgcgacgatggcgctggtcaccgactacgactgctggcac
cccgaccacggcgcggtgacggtggagctgattatcgacaacctccacaagaacgccgag
aatgcccagcgcatcgtgcgcgctgtggtggaacgcctgcacgcagcagctccgccctgc
gccagccactccgccctcaagtacgccctgctcacccaacccgaggacgtaccgcaagcc
accaagcaaaagctggctgcgatcctggccaaataccccgcctaccggcccgaggtttag

DBGET integrated database retrieval system