KEGG   Gloeobacter violaceus: glr0532Help
Entry
glr0532           CDS       T00148                                 

Definition
(RefSeq) hypothetical protein
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
gvi  Gloeobacter violaceus
Pathway
gvi00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:gvi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    glr0532
Enzymes [BR:gvi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     glr0532
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ham1p_like
Motif
Other DBs
NCBI-GeneID: 2599639
NCBI-ProteinID: NP_923478
CYORF: glr0532
UniProt: Q7NN81
Position
569381..569968
Genome map
AA seq 195 aa AA seqDB search
MMRFLILATNNQGKLQELRRLLAGTGWVVQAAPPDFAVEETGTTFAENARLKALAAAERT
GEWSVGDDSGLAVDALGGAPGVYSARYGRNDGERISRLLAALAGQADRGARFICAIALAE
PGRVLKEVEAECRGVILHAPRGNGGFGYDPIFLVPELDKTFAELDIVEKERHSHRGRAVR
KLLSGCSRGTFIVDH
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgtttcctaatattggcaacaaacaatcaaggaaagctacaggaactgcgccgt
ttactcgctggcacgggctgggtggtgcaggcggccccgccggattttgcggtggaggaa
accgggacgacctttgctgagaacgctcgcctcaaggccctcgcggcggcggagcgcacg
ggggagtggagtgtgggggacgattcgggtttggcggtcgacgccctcggcggagcgccg
ggagtgtattcggcgcgctacggccgcaacgacggtgagcgcatctcccgcctgctcgct
gcgctggcggggcaagccgaccggggtgcgcgcttcatctgcgccatcgccctggccgaa
cccggccgggtactgaaagaggtcgaagccgaatgccggggcgtcatcctgcacgccccg
cgcggcaacggcggctttggctacgacccgatttttctggtgcccgaactggacaaaacc
tttgccgaactcgacatcgtcgagaaagagcgccacagccaccggggccgggcagtgcgc
aagttgctctcggggtgcagccgaggtacgttcattgttgaccattag

DBGET integrated database retrieval system