KEGG   Gloeobacter violaceus: glr1000Help
Entry
glr1000           CDS       T00148                                 

Definition
(RefSeq) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
gvi  Gloeobacter violaceus
Pathway
gvi00430  Taurine and hypotaurine metabolism
gvi00620  Pyruvate metabolism
gvi00640  Propanoate metabolism
gvi00680  Methane metabolism
gvi01100  Metabolic pathways
gvi01120  Microbial metabolism in diverse environments
gvi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gvi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    glr1000
   00640 Propanoate metabolism
    glr1000
  09102 Energy metabolism
   00680 Methane metabolism
    glr1000
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    glr1000
Enzymes [BR:gvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     glr1000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-GeneID: 2599118
NCBI-ProteinID: NP_923946
CYORF: glr1000
UniProt: Q7NLW9
Position
1071423..1072640
Genome map
AA seq 405 aa AA seqDB search
MKVLVLNAGSSSQKSCLYDLPHTQLPQEPPQPLWEAQIDWPHGGDGAKLKIKTVHHRHEK
TLQGGSRSEDSARMLETLYSGETRVIADPSEIEMVGHRVVHGGEAYRESTRITPEVKAAI
DQLARFAPVHNPANLAGIEALEALLGPQVPQIAVFDTAFHSRLPAAAYVYPGPYEWLDQG
IRRYGFHGISHRYCAERAAQILGRDLAQLRLITCHLGNGCSLAAVQGGFSIDTTMGFTPL
EGLMMGSRSGSVDPGILIHLMRQADYTVDKLDHILNQASGLEGVSGISNDLRPLFKAIDE
GNARAKLALDIYIHRLRAGIGAMAVSLGGLDALIFTAGVGENAAPVRAGACEALGFLGVA
LDPQKNNGRPRDADIAAADSAVRVLVIHTQEDWAIARECWQHLRR
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagtactcgttctcaacgccggttcgagcagccagaaaagctgcctgtacgacctg
ccgcacacccagctgccccaggagccgccgcagccgctgtgggaagcacagatcgactgg
ccccacggcggagatggcgcaaagctgaagatcaaaaccgtccaccatcgacacgaaaaa
accctgcaaggcgggtcgcgctccgaagacagcgcccggatgctcgaaactctctacagc
ggcgagacccgggtgatcgcagatccaagcgaaatcgagatggtcggacatcgggtcgtc
cacggcggtgaagcgtaccgcgagagcacccggatcacccccgaggtgaaggcagccatc
gatcagctcgcacgctttgcgccggtgcataacccggccaacctcgccggtatcgaagcg
ctcgaagcgctcctcggcccgcaggtgccccaaatcgccgttttcgacaccgccttccac
agccgcctgcccgctgctgcctacgtctaccccggtccttacgagtggctcgatcagggc
atccgtcgctacggcttccacggcatcagccaccgctactgcgccgagcgcgccgcccag
atcctcgggcgcgacctggcgcagttgcgcctgatcacctgtcatctgggcaacggctgt
tcgctcgccgccgtgcagggcggcttcagcatcgataccaccatgggatttacgcccctg
gaaggactgatgatgggcagccgctcaggctccgtcgaccccggcattttgattcatctg
atgcgccaggccgactacaccgtggacaagctcgatcacatcctcaaccaggcttcgggg
ttggaaggcgtctccgggatttccaacgacctgcgcccgctcttcaaagcgatcgacgaa
ggcaacgcccgcgccaaactggcgctcgatatatacatccaccgactgcgtgccgggatc
ggagcgatggccgtgagcctgggcggcctcgacgccttgatctttactgccggggtggga
gaaaacgcagcccccgtgcgcgccggagcctgcgaagcgctgggatttctcggggtggcc
ctcgacccccaaaagaacaacggccgacccagggacgcagacattgccgccgcggattca
gcggtgcgggtgctggtcattcacacccaggaggactgggcgattgcccgggaatgctgg
cagcacctgcgccgttga

DBGET integrated database retrieval system