KEGG   Gloeobacter violaceus: gvip056Help
Entry
gvip056           CDS       T00148                                 

Gene name
gap1
Definition
(RefSeq) glyceraldehyde-3-phosphate dehydrogenase
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
gvi  Gloeobacter violaceus
Pathway
gvi00010  Glycolysis / Gluconeogenesis
gvi00710  Carbon fixation in photosynthetic organisms
gvi01100  Metabolic pathways
gvi01110  Biosynthesis of secondary metabolites
gvi01120  Microbial metabolism in diverse environments
gvi01130  Biosynthesis of antibiotics
gvi01200  Carbon metabolism
gvi01230  Biosynthesis of amino acids
Module
gvi_M00002  Glycolysis, core module involving three-carbon compounds
gvi_M00165  Reductive pentose phosphate cycle (Calvin cycle)
gvi_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
gvi_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:gvi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    gvip056 (gap1)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    gvip056 (gap1)
Enzymes [BR:gvi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     gvip056 (gap1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C Gp_dh_N NAD_binding_3 GFO_IDH_MocA
Motif
Other DBs
NCBI-GeneID: 2599637
NCBI-ProteinID: NP_923476
UniProt: Q7NN83
Position
567754..568770
Genome map
AA seq 338 aa AA seqDB search
MTIKVAINGFGRIGRNFLRCWLGRKQSDFEVVAINDTSDPNTNAHLLKYDSMLGQFSGEV
SADENSLTANGHTIKCFSDRNPLNLPWKDWGVDLVIESTGVFTSRDGASKHLAAGAKKVL
ITAPGKNDDGTFVMGVNDHNYDPEKHTIISNASCTTNCLAPVAKVLHENFKIVKGTMTTI
HSYTGDQRLLDASHRDWRRARAAALSIVPTSTGAAKAIGLVLPELKGKLDGLAFRVPTPN
VSVVDLVVEVEKPTLVEQVNHVLKEASENELKGILAFSEIPLVSIDYRITDVSSIVDAQL
TMVLKDNLVKVISWYDNEWGYSQRVVDLAELVARKWAA
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgacgattaaagtagcaatcaacggcttcgggaggatcgggcgcaacttcttgcgctgc
tggttgggtcgcaaacagtcggattttgaagtcgttgccatcaacgacacctccgacccc
aacaccaatgcacacctgcttaagtacgattcgatgctgggccagttcagcggcgaggtg
agcgccgacgaaaattcgctcaccgccaacggtcacaccatcaagtgcttttccgaccgc
aatccgctcaatctaccctggaaggattggggtgtcgatctggtgatcgaatcgacgggt
gtattcaccagccgcgacggtgcctccaagcaccttgccgccggcgccaaaaaagtgctc
atcaccgcgccgggcaagaatgacgacggcaccttcgtcatgggtgtcaacgatcacaac
tacgaccctgagaagcacacgattatctccaatgcttcttgcaccaccaactgcctggcc
ccggtggccaaggtgctccacgagaacttcaagatcgtcaagggcacgatgaccaccatc
cacagctacaccggcgaccagcgcctgctcgatgcgagccaccgcgactggcgccgcgcc
cgcgctgctgccctcagcatcgtgcccaccagcaccggggcggccaaggccatcggcctg
gtgctgcccgaactgaagggcaagctggatggtctggccttccgggtgcccacccccaac
gtctcggtggtggacctggtggtcgaagtcgaaaaacccacccttgtcgagcaggtcaac
cacgtcctcaaagaggcctccgagaacgaactcaaaggcatcctcgcctttagcgaaatt
ccgctagtgtcgatcgactaccggattaccgacgtctcgtcgatcgtggacgcccagctc
accatggtgctcaaggacaacctggtaaaggtgatctcctggtacgacaacgagtggggc
tactcccagcgcgtcgtcgatttggccgaactggtcgcccgcaagtgggcagcttaa

DBGET integrated database retrieval system