KEGG   Gloeobacter violaceus: gvip221Help
Entry
gvip221           CDS       T00148                                 

Gene name
folE
Definition
(RefSeq) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
gvi  Gloeobacter violaceus
Pathway
gvi00790  Folate biosynthesis
gvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gvi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    gvip221 (folE)
Enzymes [BR:gvi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     gvip221 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF BAR
Motif
Other DBs
NCBI-GeneID: 2598546
NCBI-ProteinID: NP_924526
UniProt: Q7NK98
Position
complement(1699078..1699722)
Genome map
AA seq 214 aa AA seqDB search
MTIAHKDFLPSDWHEDDSASEAASRNGLDPMMDAVRTLLVGVGEDPERNGLERTPKRVAE
ALKFLTKGYGQSLEELLNGAIFDLGHDELVLVRDIDLFSMCEHHMLPFIGRAHVGYIPDQ
KVVGLSKLARIVEMYARRLQVQERLTRQIAEALQEVLQPRGVAVVIEASHMCMVMRGVQK
PNSWTVTSSMVGVFKESQSTRQEFLDLIHHKATF
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgacgattgcccacaaggattttctgccttccgactggcacgaagacgactccgcttca
gaagccgcaagccgcaacggcctcgacccgatgatggacgcggtccgcacgcttttagtc
ggggtgggcgaggatcccgagcgcaatggcctggagcgcacacccaagcgagtggcggag
gcgctgaagtttctcaccaaaggctatggtcagtcgctcgaagaactgctcaacggcgcc
atcttcgacctcgggcacgacgagttggtgctggtgcgcgatatcgatctattcagcatg
tgtgagcaccacatgctgccgtttatcggccgagcccacgtcggttatatccccgaccag
aaggtggtgggcctgtcaaaacttgcccgcatcgtcgagatgtacgcccgtcgcctgcag
gtgcaggagcgcctcacccgccagatcgccgaggcgctgcaggaggtgttgcagccgcgg
ggtgtggcggtggtgatcgaagcctcgcacatgtgcatggtgatgcgcggcgtgcagaag
cccaattcctggacggtgaccagttcgatggtgggggtcttcaaagagagccagtccacc
cgccaggaatttctggacctgatccaccacaaggcgacgttttaa

DBGET integrated database retrieval system