KEGG   Gloeobacter violaceus: gvip326Help
Entry
gvip326           CDS       T00148                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
gvi  Gloeobacter violaceus
Pathway
gvi00260  Glycine, serine and threonine metabolism
gvi00750  Vitamin B6 metabolism
gvi01100  Metabolic pathways
gvi01110  Biosynthesis of secondary metabolites
gvi01120  Microbial metabolism in diverse environments
gvi01230  Biosynthesis of amino acids
Module
gvi_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:gvi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    gvip326 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    gvip326 (thrC)
Enzymes [BR:gvi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     gvip326 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP TF_Zn_Ribbon
Motif
Other DBs
NCBI-GeneID: 2600763
NCBI-ProteinID: NP_925308
UniProt: Q7NI22
Position
complement(2524335..2525522)
Genome map
AA seq 395 aa AA seqDB search
MFAFISHLICPRCDSRFDPRKVHNLCTACASPLLVEYDLEQVRASVDKETLARRGESMWR
YRELLPVMDPAHIVSFGEGFTPLLPIDALTRTWGLETVWIKDDGLNPTGSFKARGASCGI
SKAKELGIREVALPTAGNAGGAWACYGAAAGLRVHVAMPRDAPAVNQLECRLYGADLTLV
DGLISDAGKLIAQGVREHGWFDVSTLKEPYRIEGKKTLGLELAEQMNWQLPDAILYPAGG
GVGIIGIWRGLQQLKAMGWVTGSLPRLIVVQAEGCAPLVKAFEEGRTESEFWPDARTFAS
GLRVPKALGDFLVLQAVRETGGTAIAVSDEQCGEMMKLLAGRTGIFAAPEGAATLAAAKI
LRERGDLASRDRVVLINTGSALKYPEAMSEALAMR
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcttttatcagccatttgatttgcccgcgctgcgacagccgctttgatccgcgc
aaagtccacaacctttgcactgcctgcgcttcgcctttgttggtcgagtacgacctcgaa
caggtccgtgcctcggtggataaagagacgctcgcccgccgcggcgagtcgatgtggcgc
taccgggaactgctgcccgtgatggacccggcccatatcgtgagcttcggcgaagggttc
acaccactgctacccatcgacgcgctcacccgaacctggggattggagacagtctggatc
aaagacgacgggctcaatcctaccggctccttcaaggcgcggggtgcctcctgcggcatc
tcgaaggctaaagaactcggtatccgggaggtggccctgcccacggcgggcaacgcgggc
ggtgcctgggcctgctacggggccgccgccggtttgcgcgtgcacgtggcgatgcccagg
gacgccccggccgtcaaccagctcgaatgccgtctgtacggcgcggatctgacattagtg
gacgggttgatttcggacgcgggaaaattgattgcccagggggtgcgcgagcatggctgg
ttcgacgtctcgacgctcaaggagccttaccgcatcgagggcaagaagaccctgggtctt
gaacttgccgagcagatgaactggcagttgcccgatgccatcctctacccggccgggggc
ggcgtcggaatcatcggcatctggcggggcttgcagcaattgaaagcgatgggctgggtg
acgggaagtctgccccggctcattgtcgtgcaggcagaaggctgcgctccgctggtcaag
gcgttcgaggagggccgcaccgagtccgaattctggccggatgcccggacttttgcctcc
ggactgcgcgtacctaaggccctgggcgattttctggtgctgcaggcggtgcgcgagacc
ggcggcaccgccatcgccgtcagcgacgagcagtgcggcgagatgatgaaacttttggcc
ggtcgcaccgggatatttgcagcaccggaaggagccgccaccctggctgccgccaaaatc
ctgcgcgagcgcggcgatctggcttcccgcgatcgggtggtgctcatcaacaccggctcc
gctctcaagtacccggaggcaatgagcgaggcactggcgatgcggtag

DBGET integrated database retrieval system