KEGG   Gloeobacter violaceus: gvip390Help
Entry
gvip390           CDS       T00148                                 

Gene name
desC
Definition
(RefSeq) delta 9 acyl-lipid desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
gvi  Gloeobacter violaceus
Pathway
gvi01040  Biosynthesis of unsaturated fatty acids
gvi01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:gvi00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    gvip390 (desC)
Enzymes [BR:gvi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     gvip390 (desC)
Lipid biosynthesis proteins [BR:gvi01004]
 Desaturase
  First
   gvip390 (desC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase DUF3307
Motif
Other DBs
NCBI-GeneID: 2601267
NCBI-ProteinID: NP_925812
UniProt: Q7NCW0
Position
complement(3057506..3058357)
Genome map
AA seq 283 aa AA seqDB search
MTANVVSGAGGVAGWRALNWPTLGFLVLMHGLALLAPWFFNWQALAVALGLHWLIGSLGI
CLGYHRLLTHRSFRVPRGLECVFAMLGALALQGGPIFWVAAHRLHHAHADDDARDPHSSG
RGFWWSHVLWLLYRHPELSDGQTHRKYAPDLARQPFYRWLNRYHLLLQIPLAVLLFALGG
WPFVVYGVFVRAVVLWHTTWLINSAAHLAGYRTSEVPDSSRNLWWAALLTYGEGWHNNHH
AQPNAARAGLRWWEVDMTWWVIRALEMAGLATQVVPPRPNPVR
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgactgcgaatgtcgtttcgggcgccgggggcgttgctggttggcgcgcgctcaactgg
cccaccctgggctttttggtcctgatgcacgggcttgctctgctggcaccctggtttttc
aactggcaggcattggcggttgccctcgggttgcattggctcatcggcagcctgggcatc
tgtctgggttaccaccggcttttgacccaccgcagctttcgggtgccgagggggttggag
tgtgtttttgcgatgctgggagccctggcgctgcagggcggccccatcttctgggtggca
gcccaccggctgcaccatgcccacgccgacgacgacgcccgagacccccactcctccggc
cggggcttctggtggagccatgtgctgtggcttctctaccggcacccggaactttccgat
ggccaaacccaccgcaagtacgccccggatttggcccgtcaaccgttctaccgctggctg
aaccgctaccacctgctgctgcagattcctttggcggtgctgctatttgcgctggggggc
tggccgtttgtggtctatggagtgttcgtgcgtgcggtcgtgctctggcacaccacctgg
ctcatcaactccgccgcccacctggcaggttaccgcaccagcgaggtgccggacagttcg
cgcaacctctggtgggcggctctgctcacctacggcgagggctggcacaacaaccaccat
gcccaaccgaacgccgcgcgggcgggcctgcggtggtgggaagtggacatgacctggtgg
gtgattcgagcgctggaaatggccgggttggcgacacaggtggtcccaccccgaccaaat
ccggtgcggtga

DBGET integrated database retrieval system