KEGG   Gloeobacter violaceus: gvip500Help
Entry
gvip500           CDS       T00148                                 

Gene name
cobB
Definition
(RefSeq) cobyrinic acid a,c-diamide synthase
  KO
K02224  cobyrinic acid a,c-diamide synthase [EC:6.3.5.9 6.3.5.11]
Organism
gvi  Gloeobacter violaceus
Pathway
gvi00860  Porphyrin and chlorophyll metabolism
gvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gvi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    gvip500 (cobB)
Enzymes [BR:gvi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.9  hydrogenobyrinic acid a,c-diamide synthase (glutamine-hydrolysing)
     gvip500 (cobB)
    6.3.5.11  cobyrinate a,c-diamide synthase
     gvip500 (cobB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 E1_dh AAA_19 MobB GXWXG 6PF2K
Motif
Other DBs
NCBI-GeneID: 2602099
NCBI-ProteinID: NP_926641
UniProt: Q7NF32
Position
3905624..3906982
Genome map
AA seq 452 aa AA seqDB search
MAIIIAAPASGTGKTTITLALLAYLKAHALRVRSFKVGPDYIDPMFHAAVTGQGCVNLDL
FLTDEPFVRATYHHHCRGQQAAVIEGVMGLFDGRAGQGDFASTAHVARLLRLPVILVIDG
SGAGFSVAATLYGFRRFDPRVRIAGVILNRVGSERHAQILSEAVRSQGLELLGTVYKDET
IALPHRHLGLVPVEELSDFRRTQQQLAALAERSFDWQKLLPLVAIQPTAPAPARWEAEPL
PPVRIAVARDRAFSFYYQDNLELLAALGAQLETFSPLAGEWPDCRGYLLGGGFPELCAGE
LSAKTRFWEGLRGAVARGVPLYAECGGLMVLGEALRTPEGRSHPMAGILEASCWMGKRTV
LGYRVATALHSSCAVEAGRQLRGHLFHRSRMEPQPGAPLWQLDDDEQEGWVRGNLHASYL
HLHWGTQAWAARRFVRRCLAVAFEGKSTPARF
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcatcattgcagccccggcgagcggcaccggcaagacgacgataaccctcgct
ctgcttgcctacctcaaggcccacgccttgcgggtgcgctcgttcaaggtcggccccgat
tatatcgacccgatgttccacgccgccgtcaccggccagggctgcgtcaatctcgacttg
tttttgaccgacgaaccgttcgtgcgcgccacctaccaccaccactgccggggccagcag
gcggccgtgatcgaaggggtaatggggctattcgacggacgggcgggtcagggcgatttt
gccagcaccgcccacgtcgcccgcctgttgcgcttgccggtgatcctggtcatcgatgga
tcgggggccggcttttcggtggcggccaccctctacggatttcgccgcttcgacccgcgc
gtgcgcatcgccggggtgatcctcaaccgggtgggctccgagcgccacgcccaaatcctc
tctgaggctgtgcgcagccagggtctcgaactattgggaaccgtctacaaagacgaaacg
atcgccctgccgcaccgccacctgggattggtgccggtggaggaactgtccgactttcgg
cgcacccagcagcagttggctgccctcgccgagcgctccttcgactggcagaaattgctg
ccgctggtggccatccaacctaccgcccccgccccggcgcgctgggaagcggagccattg
ccgccggtgcgcatcgccgtcgcccgcgaccgggccttcagcttctactaccaggacaat
ctggaattgctcgcggccctgggggcgcagctggagaccttttcgcctttggccggcgag
tggcccgattgccggggttacttgttgggaggcggttttcccgagctgtgcgcgggcgaa
ctcagcgcaaaaacccgcttctgggaaggactgcggggggcggtggcccgtggggtgccc
ctctatgccgagtgcggcgggttgatggtgctgggcgaagcgctgcgcacccccgagggc
cgctcccacccgatggcgggcatcctggaggccagttgctggatgggcaaacgcacggta
ctgggctaccgggtggccacggctttgcacagttcctgcgccgtcgaagccggcagacag
ttgcgcggccacctgtttcaccgctcgcgcatggaaccccagccgggcgcgccgctgtgg
caactcgacgacgatgagcaagaaggctgggtgcgcggcaatctgcacgcttcgtatctg
cacctgcactggggtacccaggcgtgggcggcccgccgcttcgtgcgccgctgtctggcg
gtcgctttcgagggaaaatccaccccggcccgcttctga

DBGET integrated database retrieval system