KEGG   Geobacillus sp. WCH70: GWCH70_0033Help
Entry
GWCH70_0033       CDS       T00915                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
gwc  Geobacillus sp. WCH70
Pathway
gwc00450  Selenocompound metabolism
gwc00970  Aminoacyl-tRNA biosynthesis
gwc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gwc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    GWCH70_0033
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    GWCH70_0033
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:gwc01007]
    GWCH70_0033
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:gwc03016]
    GWCH70_0033
Enzymes [BR:gwc01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     GWCH70_0033
Amino acid related enzymes [BR:gwc01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   GWCH70_0033
Transfer RNA biogenesis [BR:gwc03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    GWCH70_0033
 Prokaryotic type
   Other AARSs
    GWCH70_0033
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f DUF4455 HTH_Tnp_1 tRNA-synt_1d DNA_ligase_ZBD Zn-ribbon_8
Motif
Other DBs
NCBI-ProteinID: ACS22975
UniProt: C5D359
Position
44009..45955
Genome map
AA seq 648 aa AA seqDB search
MEKKTFYLTTPIYYPSGKLHIGHAYTTVAGDAMARYKRLRGYDVMYLTGTDEHGQKIQRK
AEEKGVTPQQYVDEIVEGIQELWKKLDISYDDFIRTTQERHKKVVEKIFARLVEQGDIYL
GEYEGWYCTPCESFYTERQLVDGNCPDCGRPVEKVKEESYFFRMSKYVDRLLQYYEENPE
FIQPESRKNEMINNFIKPGLEDLAVSRTTFDWGIKVPGDPKHVIYVWIDALTNYITALGY
GTDNDEKFRKYWPADVHLVGKEIVRFHTIYWPIMLMALDLPLPKKVFAHGWLLMKDGKMS
KSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINYDLANDLGNLLNR
TVAMIEKYFDGMIPPYRGAKTAFDNDLVEKAKETVKQYEEAMEKMEFSIALASVWQLINR
TNKYIDETQPWLLAKDEGKKEQLASVMTHLAESLRHVAILLQPFLTRTPEKIFAQLGIVD
EQLKQWDSLYEFGLIKEGTKVTKGEPLFPRLDIEKEVEYIKAHMQGSAPAKQTEEKPKQE
AQEITIDDFMKVDLRVAEVLHAEPVKNADKLLKLKLDLGDEQRQVVSGIAQFYKPEDLIG
KKVVCVANLKPVKLRGELSEGMILAGEENGVLSLVTVDKTIPNGTKIK
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaaagacgttttatcttacgaccccgatttactatccgagcgggaaattacat
attggccatgcatatacgaccgtagcaggcgatgcgatggcgcgctataagcgtcttcgc
ggttatgatgtcatgtatttgactggtacggacgaacatggacaaaaaattcagcgaaaa
gcggaagaaaaaggagtaacaccgcagcaatatgtcgacgaaattgtcgaaggcatccaa
gagttgtggaaaaagcttgatatttcttatgatgacttcatccgtacgacgcaagaacgt
cataaaaaagtagtagaaaagatttttgcgcgtcttgtcgaacaaggtgatatttattta
ggtgaatacgaaggatggtattgtacaccgtgcgaatcattttatacggagcggcagctc
gttgatggaaactgcccggattgcggccgtccggtagagaaagtaaaagaagaatcgtat
ttctttagaatgagcaaatatgtggatcggcttttgcaatactatgaagaaaatccggag
ttcatccagccggagtcgcgcaaaaatgaaatgattaacaactttattaaaccagggctt
gaggatttagcggtatcacgcacgacgtttgattggggcattaaagttccgggtgatccg
aaacacgtcatttacgtatggattgacgcgctcacgaactatattacggcattaggatat
ggcacggataacgatgagaagtttcgaaaatactggccggcagacgttcatttagtcgga
aaagaaattgtccgcttccatacgatttactggccaataatgttaatggcgctcgatttg
ccgcttccgaaaaaagtgtttgcccatggctggctgttaatgaaagacggaaaaatgtcg
aaatcaaaaggaaatgtcgttgatccggtaacattaatcgaccgttatggattggatgca
cttcgctattatttgcttcgcgaagttccgtttggctccgatggcgtgtttactccagaa
ggatttgtcgaacgcattaactacgacttagcaaacgatttaggcaacttgttaaatcgc
acggtagcgatgattgaaaaatattttgacggcatgattccaccatatcgtggagcgaaa
acagcattcgacaacgatcttgtcgaaaaggcaaaagaaacggtgaaacaatatgaagaa
gcgatggagaaaatggaattttccattgcgcttgcgtccgtatggcagctgattaaccga
acgaataaatatattgacgaaacgcaaccttggctgcttgccaaagatgaaggcaaaaaa
gaacaattggcgtctgtaatgacccatttggcagaatcacttcgtcatgttgcgattttg
ttgcagccgtttttaacacgcacgccggaaaaaattttcgcgcagcttggcattgttgat
gaacaattaaaacaatgggacagcttatatgagttcggcctcatcaaggaaggcacgaaa
gtaacaaaaggtgaaccgctatttccacgtctagacattgaaaaagaagtggaatatatt
aaagcccatatgcagggcagtgcaccggcaaaacaaacggaagaaaaaccaaaacaagaa
gcgcaagaaattacgattgatgattttatgaaagttgatttgcgagttgcagaagtactt
cacgctgagccggtaaaaaatgcggataaactgctgaagctcaagcttgatcttggcgat
gaacaacgtcaagtcgtatcaggaattgcgcaattttacaaaccagaggatttgatcggc
aaaaaagtggtttgcgtcgccaatttaaaaccagtgaaactgcgcggtgaactatccgaa
ggtatgattctcgccggggaagaaaacggggtgctttctcttgttaccgttgataaaacg
attccaaatgggacaaaaataaaataa

DBGET integrated database retrieval system