KEGG   Geobacillus sp. WCH70: GWCH70_0919Help
Entry
GWCH70_0919       CDS       T00915                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E1 subunit
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
gwc  Geobacillus sp. WCH70
Pathway
gwc00020  Citrate cycle (TCA cycle)
gwc01100  Metabolic pathways
gwc01110  Biosynthesis of secondary metabolites
gwc01120  Microbial metabolism in diverse environments
gwc01130  Biosynthesis of antibiotics
gwc01200  Carbon metabolism
Module
gwc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gwc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gwc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GWCH70_0919
Enzymes [BR:gwc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     GWCH70_0919
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: ACS23783
UniProt: C5D802
Position
978586..981444
Genome map
AA seq 952 aa AA seqDB search
MTKQTMNYAEPWSQFYGPNLGYVMEMYEQYLEDPDSVDPELKQLFKEWGAPTTEAERFDH
SESAAKTYQTFRLPENPTIFSKLVAAVKLADKIRHYGHLAADINPLNTQNKDTRRIELSE
FDLTEDDLKQIPVAFICPHAPAHVKNGLDAINHLRKIYTDKIAFEFSQVHNLEERNWLIS
QIESGAYYPSLTNEEKVALLRRLTEVEGFEKFLHRTFVGQKRFSIEGLDSMVPLLDELIR
HSIEEEVKAVNIGMAHRGRLNVLAHVLGKPYEMIFAEFQHAESKDFMPSEGSVAITYGWT
GDVKYHLGAARRLRNKNEHTMRITLANNPSHLEVVNPVVLGFTRAAQEDRSNAGVPSQDT
DSAFAIMIHGDAAFPGQGIVAETLNLSRLQGYQTGGSIHIIANNMIGFTTESYDSRSTKY
ASDIAKGFEIPIVHVNADDPEACLAAANLAFAYRKRFKKDFVIDLIGYRRFGHNEMDEPM
ATNPTMYSIIQQHPTVRQLYAQKLIEKGIITKEAVEEMEREVAERLKIAYEKVPKDESKL
DFIMDPPKPVASKLPFVKTSVEKDVLRRLNKELLQFPSDFHVFNKLERILKRREGVFDGK
GKIDWAHAEILAFATILRDGVPIRLTGQDSQRGTFAQRHLVLHDMKTGEEFVPLHHISDA
NASFVVYNSPLTEAAVLGYEYGYNVFAPETLVLWEAQFGDFANMAQVMFDQFISSGRAKW
GQKSGLVMLLPHGYEGQGPEHSSGRLERFLQLAAENNWTVANLSTAAQYFHILRRQAGIL
QREEVRPLVLMTPKSLLRHPLAASDVEEFTNGQFHPVIEQKGLGENREKVERIILCTGKF
AIDLAEQINKMEGLDWLHIVRVEELYPFPKEELQAIFARYPNVKEIIWAQEEPKNMGSWC
YVEPKLREIAPDEVDVSYIGRRRRASPAEGDPVVHRKEQERIIQCALTKKEQ
NT seq 2859 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagcagacgatgaactacgcagaaccatggagtcaattttatggcccgaacctt
ggatacgtgatggaaatgtatgagcagtatctagaggatccggacagcgtagatcccgaa
ttgaaacaattgtttaaggagtggggagcaccgacaacggaagcagaacggtttgatcat
agcgagagtgccgccaaaacttatcaaacgttccggcttcctgagaatccaaccatattc
agcaaacttgttgctgctgtaaaactagctgataaaattcgccattatggccatctagca
gcggatatcaacccattaaatacccaaaataaagatacgcgccgtatcgaattaagcgaa
tttgatttaacggaagatgatttaaaacaaattcctgtcgcatttatttgtccgcatgcg
cctgcgcatgtgaaaaatggattggatgccattaaccatttgcggaaaatctacacggat
aaaatcgctttcgaattttcacaagtacataacttagaagaaagaaattggttaattagc
caaattgaatcaggagcatattacccaagtctgacaaacgaagaaaaagtggcgctgctc
cgccgccttacggaagtggaagggtttgaaaagttccttcatcgtacgtttgtcggccaa
aaacgtttctcgatcgaaggattagattcgatggttccactattagacgaacttatccgc
cattccattgaagaagaagtgaaagcagttaatatcggcatggcgcatcgcggccgctta
aacgtgcttgctcacgtccttggaaagccatatgaaatgatttttgctgagttccaacat
gcggaaagtaaagatttcatgccgtcggaaggatcggtagcgattacatatggctggacg
ggagatgtgaaatatcatttaggggcagcccgccgtcttcgaaacaaaaatgaacatacg
atgagaattacattggcaaacaacccaagccatctagaagtggtcaatcctgttgtttta
gggtttacgcgcgctgctcaagaggatcgctcgaatgcgggtgtgccgtctcaagacaca
gattcggcgtttgccattatgattcacggagacgcggcatttcctgggcaaggcattgta
gccgaaacactaaacttaagccgtttgcaaggatatcagacaggcggatcgattcatatt
attgcgaataatatgatcggtttcacaacagaaagttatgattctcgttctacgaaatat
gcatctgatattgcaaaaggttttgaaataccgattgtgcatgtgaacgccgacgatccg
gaagcatgtttagcagcggcgaaccttgcgtttgcctatcgtaagcgtttcaaaaaagat
tttgttatcgacttaattggctaccgccgttttggccataacgaaatggatgagccgatg
gcgacaaacccaacaatgtatagcattattcaacagcatccaaccgttcgtcagctttat
gcgcaaaagttgattgaaaaaggaattattacgaaagaagcagtagaagagatggaacga
gaagttgccgaacggttgaaaatcgcgtacgaaaaagttccaaaagacgagtcaaagctt
gattttatcatggatccgccaaagccggtagcaagcaagttaccatttgtaaaaacatca
gtagaaaaagatgtattgcgccggttgaataaagaactgttgcagtttccttctgatttc
catgtatttaataagttagaacgcatcttaaagcgccgtgaaggcgtgtttgacggcaaa
ggaaaaattgactgggcgcacgcggagattcttgcttttgcaacgattttgcgcgatggt
gttccaatccgccttactggccaagattcgcagcgcggtacgtttgcccaacgtcatctt
gtgttacatgatatgaaaacgggtgaagaatttgttccgcttcaccatattagcgatgca
aatgcttcattcgttgtttacaatagcccgctgacagaagcagcagtgcttggttacgaa
tacggatataacgtttttgctccggaaacgctcgttttatgggaagcacaattcggtgat
ttcgcgaatatggcgcaagtgatgtttgatcagtttatttcatccggacgggcgaaatgg
ggacaaaaatccgggcttgttatgttgcttccacatgggtatgaagggcaaggtccggaa
cattcaagtggccgtttagaacgattcttgcaattagcagcggaaaataactggacggtg
gctaacttgtcaactgctgctcaatatttccatattttgcgtcgacaagctggcattttg
cagcgggaggaagttcgcccattagtgctgatgacgccaaaaagcttgctgcgccatccg
ttggcggcatcggatgtggaagagtttacgaatggccaattccatcctgtgattgaacaa
aaggggcttggcgaaaaccgcgaaaaagtagaaagaatcattttatgcactggaaagttt
gcgattgatttggcagaacaaatcaataaaatggaagggctagactggcttcacatcgtg
cgcgtagaagaattgtacccattcccgaaagaagagctccaagcaatttttgcgcgctat
ccaaatgtaaaggaaatcatatgggctcaagaagagccgaaaaacatgggaagctggtgt
tatgttgagccgaaattgcgagaaattgctccagatgaagtagatgtaagctatatcggc
agacgcagacgggcaagccctgcagaaggtgatcctgtcgttcatcgaaaagagcaagag
cgtattattcaatgcgcattaacgaaaaaagaacaataa

DBGET integrated database retrieval system