KEGG   Geobacillus sp. WCH70: GWCH70_1096
Entry
GWCH70_1096       CDS       T00915                                 

Definition
(GenBank) Ribonuclease H
  KO
K03470  ribonuclease HII [EC:3.1.26.4]
Organism
gwc  Geobacillus sp. WCH70
Pathway
gwc03030  DNA replication
Brite
KEGG Orthology (KO) [BR:gwc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    GWCH70_1096
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:gwc03032]
    GWCH70_1096
Enzymes [BR:gwc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.4  ribonuclease H
     GWCH70_1096
DNA replication proteins [BR:gwc03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    RNase H
     GWCH70_1096
   Elongation factors (archaeal)
     GWCH70_1096
SSDB
Motif
Pfam: RNase_HII Apo-VLDL-II Metal_resist
Other DBs
NCBI-ProteinID: ACS23956
UniProt: C5D8U9
Position
1147283..1148116
AA seq 277 aa
MNKYTVKEIQALLQQIDDENAPLFKEIVQDERKSVQKLVARWYKQKKQEEQAKRQWQEMS
RYERQLFEQGIEYIAGIDEAGRGPLAGPVVAAAVMLPKDAYIPGLNDSKKLSEAKREMLF
HMIQSCAISIGIGVVTAAEIDEMNIYEATKKAMIKAVEQLSPKPDYLLIDAMTLPISTPQ
QSIVKGDANSVSIAASSIIAKVTRDHFMKQLAKQYPQYGFEKNMGYGTAQHLEAIRVYGT
IDEHRRSFSPIKEMIEMKKEGKEYDQTHRQSIAGFSS
NT seq 834 nt   +upstreamnt  +downstreamnt
atgaataaatatactgtaaaagaaatacaagctctattacagcaaatcgatgatgagaat
gctcccttgtttaaagagattgttcaagatgagcgaaaaagcgtacaaaagctcgttgct
cgctggtataaacagaaaaaacaagaagaacaagcaaaaagacaatggcaggaaatgtcg
cgctatgagcggcagttgtttgaacaaggaatcgagtatatagccggcatcgatgaagcg
ggacgagggccgcttgctggtccagttgttgccgcggccgtcatgctgccgaaagatgcg
tacattccgggattaaatgactcgaaaaagctatcggaagcaaagcgggaaatgttattt
catatgattcaatcatgtgcgatttcgattggcattggcgtcgtcacagctgcggaaatt
gatgaaatgaacatctatgaagcaacaaaaaaagcgatgatcaaagcggtcgaacagctt
tcaccgaaaccggattatttattaattgatgcaatgacactgcctatatcaacaccgcaa
caaagcattgtaaaaggcgatgcaaatagcgtttcgattgcggctagttccatcattgca
aaagtgacgcgcgaccattttatgaaacagctcgcaaagcaatatccacaatatggattt
gaaaaaaatatgggatatggcactgcccagcatttagaagcgattcgcgtatacggtacc
attgatgaacaccgtcgttctttttctccgattaaagaaatgatagaaatgaagaaagaa
ggaaaggaatatgatcaaacgcatcgacaaagcattgccggtttttccagctag

DBGET integrated database retrieval system