KEGG   Geobacillus sp. WCH70: GWCH70_2141Help
Entry
GWCH70_2141       CDS       T00915                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
gwc  Geobacillus sp. WCH70
Pathway
gwc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
gwc01100  Metabolic pathways
gwc01110  Biosynthesis of secondary metabolites
gwc01130  Biosynthesis of antibiotics
gwc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gwc00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GWCH70_2141
Enzymes [BR:gwc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     GWCH70_2141
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS His_biosynth NMO FMN_dh QRPTase_C NanE
Motif
Other DBs
NCBI-ProteinID: ACS24851
UniProt: C5D3D6
Position
complement(2207537..2208313)
Genome map
AA seq 258 aa AA seqDB search
MLEQIIATKKKEIETLTLSKPLQNVQRRSLSAALKKPNRSIGLIAEVKKASPSKGLIRPD
FHPVAIAKAYEKAGADAISVLTDERYFQGHRGYLSDIKQAVQLPILRKDFIIDRIQIEES
VRIGADAILLIGEALPAKTLYELYQEAYDKGLECLVEVHQRETLENILDIFTPEIIGINN
RDLHTFVTSLETTSKVIPFVPSGSVIVSESGISTSHDLKTVQTYGADAVLVGESLMRKDD
VEAAIYELFREVESIAGP
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaacaaattattgcaacgaaaaagaaagaaatagagacactcacattgtcaaag
cctttgcaaaacgtacagcgtcgttcgttatcggcggcgctgaaaaaaccaaaccgttct
atcggtcttattgcggaagtgaaaaaggcttccccgtcaaaaggattaattcgaccggat
tttcatcctgtggcgatcgcaaaagcgtatgaaaaagcgggggcggatgcgatcagcgta
ttgacggatgaacgatatttccaaggacaccgcggctatttaagcgatataaaacaagcg
gtacagcttccgattttgcgcaaagattttattattgatcgcattcaaatcgaagagagc
gtacgaattggagctgacgcgattttattaatcggcgaagcgctgccggcaaaaacgttg
tatgagctatatcaggaagcatacgacaaaggattggaatgtttagtcgaagtgcatcag
cgcgaaacattagaaaatattttagatatttttacaccggaaatcatcggcataaacaac
cgcgatttgcatacgtttgtcacctctttggaaacgacaagcaaggtcattccgtttgtg
ccatcgggcagcgttattgtcagcgaaagcggcatcagcacttctcatgatttaaaaacg
gtgcaaacatacggtgcagacgccgtgctcgtcggagaatcgctgatgagaaaagacgac
gtggaagcagcgatttacgaattatttcgggaggttgaatccattgccggtccttaa

DBGET integrated database retrieval system