KEGG   Geobacillus sp. WCH70: GWCH70_2148Help
Entry
GWCH70_2148       CDS       T00915                                 

Definition
(GenBank) Nucleoside-diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
gwc  Geobacillus sp. WCH70
Pathway
gwc00230  Purine metabolism
gwc00240  Pyrimidine metabolism
gwc01100  Metabolic pathways
gwc01110  Biosynthesis of secondary metabolites
gwc01130  Biosynthesis of antibiotics
Module
gwc_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
gwc_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
gwc_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:gwc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    GWCH70_2148
   00240 Pyrimidine metabolism
    GWCH70_2148
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gwc04131]
    GWCH70_2148
Enzymes [BR:gwc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     GWCH70_2148
Membrane trafficking [BR:gwc04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    GWCH70_2148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: ACS24858
UniProt: C5D3E3
Position
complement(2214703..2215152)
Genome map
AA seq 149 aa AA seqDB search
MMQRTFIMVKPDGVQRNLIGEIVARFEKKGFQLVGAKLMQVSRELAEQHYAEHKERPFFG
ELVDFITSGPVFAMVWEGENVIAAARQMMGKTNPQEAAPGTIRGDYGLTVGKNVIHGSDS
PESAEREIRLFFKEEELVNYSKLMNQWLY
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaaagaacgtttatcatggtcaaacctgacggggttcagcgcaacttaatcggc
gagattgttgctcgctttgagaaaaagggcttccagcttgtcggtgcaaagttaatgcaa
gtatcccgagagttagcagaacagcattatgcggaacataaagaacgtccgtttttcgga
gagctagtagactttattacatcaggccctgtatttgcaatggtatgggaaggcgaaaac
gttattgcggcggctagacaaatgatgggaaaaacaaacccgcaggaagcagcgcctggc
acgattcgcggtgattatggtctgactgtcgggaaaaacgtcattcacggttccgattcc
ccggaaagcgctgaacgggaaattcgcttatttttcaaagaagaagagcttgtcaattat
tcaaaattaatgaaccaatggctgtattaa

DBGET integrated database retrieval system