KEGG   Geobacillus sp. WCH70: GWCH70_2636Help
Entry
GWCH70_2636       CDS       T00915                                 

Definition
(GenBank) ribonuclease HIII
  KO
K03471  ribonuclease HIII [EC:3.1.26.4]
Organism
gwc  Geobacillus sp. WCH70
Pathway
gwc03030  DNA replication
Brite
KEGG Orthology (KO) [BR:gwc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    GWCH70_2636
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:gwc03032]
    GWCH70_2636
Enzymes [BR:gwc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.4  ribonuclease H
     GWCH70_2636
DNA replication proteins [BR:gwc03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    RNase H
     GWCH70_2636
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNase_HII DUF3378
Motif
Other DBs
NCBI-ProteinID: ACS25330
UniProt: C5D5R2
Position
2670713..2671618
Genome map
AA seq 301 aa AA seqDB search
MANHVITATATMLEEMRNHYASDITGHLPAGALFVAKRSGCTITAYRTGKVLFQGKEAEQ
EAAKWMKESDQKEAPVPQPPLAAASAIGSDEVGTGDYFGPVVVAAAYVAKDQMDAITAMG
IKDSKLLTDEAIRRLAPSLMNMIPNQTVILSNPMYNDWQRSGMPQTKIKALLHNEAIGKL
VKQLSPIEPEAIIIDQFIERDLYFRYLENETNVVRDHVYCYPKAETVHVAVAAASIIARY
VFLQEMERLSKEVGMTLPKGAGAQVDQAAAKLIQTHGPAILEMCAKLHFANTEKAARIAK
K
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatcacgtcatcacggcaacagcgacgatgcttgaagaaatgcggaatcattac
gcttccgatataaccggacaccttcctgcaggtgctttgttcgttgccaaacggtccggc
tgcacgatcaccgcttaccgcacgggaaaagtgctgtttcaaggaaaagaggcagaacaa
gaagcggcaaaatggatgaaagaatcggatcaaaaggaagcgccagtcccccagcccccc
ttggctgccgcatcggcaatcggctccgatgaagtcggaaccggagattatttcggacca
gttgtcgttgccgccgcatatgttgccaaagaccaaatggatgcgatcacagcaatggga
ataaaagattcgaaactgttaacggatgaagccatccgacggctcgccccgtcgcttatg
aacatgatcccgaaccaaacggttatactgtccaatccaatgtataatgattggcaacga
agcggaatgccgcaaacgaaaataaaagcgttgctgcataatgaagcgattggaaagctt
gtcaaacagctttcccctatagaaccggaagcgattattattgaccaatttattgaacgg
gacttatattttcgctacctcgaaaacgaaacaaatgtcgtccgcgatcatgtgtattgc
tacccgaaggcagaaacggttcatgttgcagtggccgctgcttcgataatcgcccgctac
gtatttttgcaggaaatggagcgattaagcaaagaagtgggcatgacattgccaaaagga
gcgggagcgcaagtcgatcaggccgccgccaagcttatccaaacgcatgggcctgccatt
ctcgaaatgtgcgcgaagcttcattttgctaataccgaaaaagcagcgcggattgctaaa
aaataa

DBGET integrated database retrieval system