KEGG   Geobacillus sp. WCH70: GWCH70_3324Help
Entry
GWCH70_3324       CDS       T00915                                 

Definition
(GenBank) Alcohol dehydrogenase zinc-binding domain protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
gwc  Geobacillus sp. WCH70
Pathway
gwc00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:gwc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    GWCH70_3324
Enzymes [BR:gwc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     GWCH70_3324
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     GWCH70_3324
    1.1.1.-  
     GWCH70_3324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N ADH_N_assoc 2-Hacid_dh_C ADH_zinc_N_2 F420_oxidored BRCA2
Motif
Other DBs
NCBI-ProteinID: ACS25964
UniProt: C5D9N6
Position
complement(3347541..3348593)
Genome map
AA seq 350 aa AA seqDB search
MKAARWYNARDIRVEEVEEPKVGKGKVKIKVEWAGICGSDLHEYAAGPIFIPVQNPHPVS
KDVAPIIMGHEFSGRVVEVGEGVTKVKVGDPVVVEPILRCGECPACKKGKYNLCDHLGFH
GLSGGGGGFSEYTVVDEYMVHKMPEGLSFEQGALVEPAAVALHAVRLSKIKPGDKAAVFG
TGPIGLLVIEALKAAGASEIYAVEVSKERLQKAKELGATSVINPKEEDPVQKLVELTDGG
VDVAFEVTGVPAVLQQAIDSTTFEGETIIVSIWEKEANIQPNNIVLKERNVKGIIAYRDI
FPAVMELMKRGYFQAEKLVTKRIKLDDIVTEGFETLMKEKDQVKILVKPE
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcgcgatggtataatgctagagacattcgagtagaagaagtagaagaaccg
aaagtaggaaaaggaaaagtaaaaattaaagtcgaatgggcgggaatttgcggaagcgat
ttacacgaatatgcggcaggcccgatttttattcctgtccaaaatcctcatcccgtcagt
aaagatgtcgctccgattatcatgggtcacgaattttcgggacgagtcgtggaagttggg
gaaggagttactaaagtcaaagttggcgatcctgtcgttgttgaaccgattcttcgctgt
ggagaatgcccagcttgcaaaaaaggaaaatacaatctttgcgatcatttaggatttcat
ggtctatccggaggaggcggcggcttctccgaatataccgttgttgatgaatatatggtg
cacaaaatgcctgaagggctttcttttgaacaaggagcgctggtggaaccggcagctgtc
gctttacatgcggttagattaagcaaaatcaagcctggcgataaagcagctgtttttggc
acggggcctataggtcttctcgttattgaagcattaaaagcagctggcgcctcggaaatt
tatgcagtagaagtttctaaagaacgtttgcaaaaagcgaaagagctcggcgctacatct
gtcatcaatccaaaagaggaagatccggttcaaaagcttgtcgaattgaccgatggcggc
gtcgatgttgcgtttgaagtaacaggagtgccggccgttttacaacaggccattgatagt
actacatttgaaggtgaaacgattatcgttagtatatgggaaaaagaagcgaacattcag
ccaaataatatcgtattaaaagaaagaaacgtaaaaggaatcattgcgtaccgcgatatt
ttccctgcggtaatggagttaatgaaacgaggctacttccaagccgaaaagctcgttacg
aaacgaattaagctagatgatattgtaacagaaggatttgaaacgctcatgaaagaaaaa
gaccaagtgaaaattttggtcaaaccagaataa

DBGET integrated database retrieval system