KEGG   Geobacillus sp. WCH70: GWCH70_3344Help
Entry
GWCH70_3344       CDS       T00915                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
gwc  Geobacillus sp. WCH70
Pathway
gwc00071  Fatty acid degradation
gwc00072  Synthesis and degradation of ketone bodies
gwc00280  Valine, leucine and isoleucine degradation
gwc00310  Lysine degradation
gwc00362  Benzoate degradation
gwc00380  Tryptophan metabolism
gwc00620  Pyruvate metabolism
gwc00630  Glyoxylate and dicarboxylate metabolism
gwc00640  Propanoate metabolism
gwc00650  Butanoate metabolism
gwc00900  Terpenoid backbone biosynthesis
gwc01100  Metabolic pathways
gwc01110  Biosynthesis of secondary metabolites
gwc01120  Microbial metabolism in diverse environments
gwc01130  Biosynthesis of antibiotics
gwc01200  Carbon metabolism
gwc01212  Fatty acid metabolism
gwc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:gwc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    GWCH70_3344
   00630 Glyoxylate and dicarboxylate metabolism
    GWCH70_3344
   00640 Propanoate metabolism
    GWCH70_3344
   00650 Butanoate metabolism
    GWCH70_3344
  Lipid metabolism
   00071 Fatty acid degradation
    GWCH70_3344
   00072 Synthesis and degradation of ketone bodies
    GWCH70_3344
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GWCH70_3344
   00310 Lysine degradation
    GWCH70_3344
   00380 Tryptophan metabolism
    GWCH70_3344
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GWCH70_3344
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GWCH70_3344
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    GWCH70_3344
Enzymes [BR:gwc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     GWCH70_3344
Exosome [BR:gwc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GWCH70_3344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD
Motif
Other DBs
NCBI-ProteinID: ACS25984
UniProt: C5D9Q6
Position
complement(3370899..3372077)
Genome map
AA seq 392 aa AA seqDB search
MGKTVILSGVRTPFGKFGGALQPLTAPELGGIAIKEALRRANISGEQVDQVILGTVLQGG
QGQLPSRQAMRYAGIPWEVRTETINKVCASGMRSVTLGDQIIRLGDAEVIVAGGMESMSN
APYILPNARWGLRMGDSTVKDLMVYDGLTCSFTGVHMGVYGGETAKELEISRKEQDEWAY
RSHQRAIAAMEAGLLAEEIVPVEVPQRKGAPLLVEHDEAPRKDTSLEKLAKLPPVFDPEG
TVTAGNAPGVNDGAAALVLMSEERAAREGRKPLATILAHTSIAVEAKDFPKTPGLVINEL
LRKTGKTVNDIDLFEINEAFAAVALASIKIAGIDPEKVNVNGGAVALGHPIGASGARIII
TLIHELKRRGGGIGIAAICSGGGQGDAIMVQV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaacggttattttaagtggggttcgcacaccgtttggaaaattcggtggagca
ctgcagccgcttacggcacctgagcttggcggcattgcgatcaaagaggcgcttcgtcga
gctaacattagcggtgagcaggtcgatcaggtcattttaggaacggtgctgcaaggtgga
caaggacagcttccatcccgtcaagcgatgcgttatgccggcattccatgggaggtgcgg
acggaaacgattaataaagtatgcgcttcaggaatgcggagcgttactcttggtgatcaa
attatccgcctaggagatgcggaagtcatcgtcgcaggcggaatggaatcgatgagcaac
gcgccatatattttgccaaatgctcgttggggattacgaatgggcgattctaccgtaaaa
gatttaatggtgtatgacgggctgacatgcagtttcaccggtgtgcatatgggtgtgtac
ggtggtgaaacggcgaaagaattagaaatttcccgcaaagaacaagatgagtgggcatac
cgcagccatcagcgggcgatcgccgcgatggaagccggattattagcggaagaaatcgta
ccagtggaagttccgcaacgtaaaggagcgccgctattggtggagcatgacgaagcacca
agaaaagatacatctctcgaaaagctggcgaagcttccgcctgtatttgacccagaaggg
acggtaacagcggggaatgcacctggggtcaatgatggtgctgcggcgctcgtgttaatg
agcgaggaaagagcggcgcgggaaggaagaaaaccgctcgcaacgattttggcacacaca
tcgattgcagtggaagcaaaagactttccgaaaacgccagggcttgtgattaacgaattg
cttcgcaaaacagggaaaacggtcaatgacatcgatttattcgaaattaacgaagcgttt
gccgcagttgcattggctagcatcaaaatcgctggcatcgatccagaaaaagtgaacgtc
aatggcggcgcggtcgcattaggccatccgatcggcgcaagcggtgcgcgcattatcatt
acattgattcacgaattaaaacgccgtggcggcggcatcggaatcgcggcgatttgcagc
ggcggcggtcaaggcgatgccattatggtacaagtatag

DBGET integrated database retrieval system