KEGG   Komagataeibacter xylinus: H845_1131Help
Entry
H845_1131         CDS       T03044                                 

Definition
(GenBank) Alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
gxl  Komagataeibacter xylinus
Pathway
gxl00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:gxl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    H845_1131
Enzymes [BR:gxl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     H845_1131
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     H845_1131
    1.1.1.-  
     H845_1131
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N TrkA_N ApbA
Motif
Other DBs
NCBI-ProteinID: AHI25076
UniProt: W5Y729
Position
1224499..1225521
Genome map
AA seq 340 aa AA seqDB search
MQAARLYGMGDIRIETVPAPVAPGPDQVRIRVMAAGICGSDLHNFRTGQWITRAPVTPGH
EFSGEVMAVGPGVTGYRPGDRVVADSRVGCGQCPSCLQGQRNLCATLGFVGEVCDGGFAG
EVTLPARQLHRVPPDMPFWLAALAEPLSVAVHAVNRLAPDPGQPVVVCGGGAIGGLAALV
LSEGHDGAVYLVERDPQRQNLLRETCGVAPVALDAVGTLVTGRSPRFMLDTTGSVAVAGH
LLGCAAPGTRLVLAGLGAARLDLDLNVIVERELEVRGVSAFADEMPQAIALLPALRERLK
AFVSIVQGVGRIPEVYGELLAQQRTGLKTLLLPHCVTEKP
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcagcacgtttatacggaatgggggacatacgcatcgaaacggttccggcgccg
gttgcgccgggtccggatcaggtgcggatacgggtcatggcagccgggatctgtggttcg
gacctgcacaattttcggacgggccagtggattacgcgcgcgcccgtcacaccggggcat
gagttttcgggtgaagtcatggcagtcgggcctggggttaccggataccggcccggggac
cgcgtggtggcagattctagggtgggatgcgggcagtgcccgtcatgcctgcagggacag
cgtaacctgtgcgccacactgggatttgtgggcgaggtctgcgatggcgggttcgcgggg
gaagtgacacttccggcccgccagttgcaccgcgttccccccgacatgccgttctggctg
gccgcactggctgaacccctgtccgtggcggtgcatgccgtaaaccggctggcccccgat
ccgggccagcctgtcgtggtctgtggcggcggggcgatcggcggccttgcggcgctggtg
ctgtccgaagggcatgatggcgcggtctatcttgtcgaacgcgacccgcagcgccagaat
ctgttgcgcgaaacctgcggggtcgcgcccgtggcgctggatgcggtcggcacccttgtc
actggccggtcgccccgtttcatgctggacaccacgggatcggttgcggtggcgggacac
ctgctgggctgcgccgcgccgggaacgcggctggttctggccgggctgggcgcggcaagg
ctcgaccttgacctgaatgttattgtcgaacgtgagctggaagtgcgtggcgtcagcgcc
ttcgccgatgaaatgccgcaggccatcgccctgctgcctgccttgcgcgaacggctgaaa
gccttcgtatccatcgtgcagggggtggggcggataccggaggtctatggggaactgctg
gcacaacagcgtacagggctgaaaacactgctcctgccccattgcgttacggagaaacca
taa

DBGET integrated database retrieval system