KEGG   Komagataeibacter xylinus: H845_1216Help
Entry
H845_1216         CDS       T03044                                 

Definition
(GenBank) Transcriptional regulator MocR family
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
gxl  Komagataeibacter xylinus
Pathway
gxl00250  Alanine, aspartate and glutamate metabolism
gxl00280  Valine, leucine and isoleucine degradation
gxl00410  beta-Alanine metabolism
gxl00640  Propanoate metabolism
gxl00650  Butanoate metabolism
gxl01100  Metabolic pathways
gxl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gxl00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    H845_1216
   00650 Butanoate metabolism
    H845_1216
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    H845_1216
   00280 Valine, leucine and isoleucine degradation
    H845_1216
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    H845_1216
Enzymes [BR:gxl01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     H845_1216
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     H845_1216
Amino acid related enzymes [BR:gxl01007]
 Aminotransferase (transaminase)
  Class III
   H845_1216
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AHI25161
UniProt: W5Y7A9
Position
complement(1330432..1331718)
Genome map
AA seq 428 aa AA seqDB search
MTLTNKDLLARRNHAVPRGVATSTPVFADRAENAELWDVEGRRYVDFAGGIAVLNVGHRH
PKVLEAVRAQLDRFTHTAFQVSAYEPYIALAEKLNALAPFEGPAKTIFFSTGGEATENAV
KIARAATGRNGIIAFTGGFHGRTLLASAMTGKVKPYKAPFGTLPGEVYHLPFPDGEEVQV
ADTLRMLDFLFAADLPASSVAAIIIEPVQGEGGFRVAPTELLVALRRICDEHGIKLVADE
VQSGFARTGRLFGIEHSGVQPDLVSVAKSMGGGLPLSGVIGRAELMDAVGPGGLGGTYGG
APLACAAGLAVLDIIRDEKLVERANTIGENLRRHIDRLHANRKLLPVSRARGLGAMIAFD
ILEEHGKPGVRAGAAAAICARACEKGLILLSCGTQGATIRILVPLTASDAIIDEGMNIIE
QVLAESAA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgacactgaccaacaaggaccttcttgcccgtcgcaaccacgccgtgccgcgcggggtg
gcgacatccacccctgttttcgccgaccgggcggaaaacgctgaactgtgggatgtggaa
ggccgccgctacgttgatttcgccggtggcatcgccgtgctgaacgtgggccaccgccac
ccgaaggtgctggaggccgtgcgcgcgcagcttgaccgcttcacgcataccgcgttccag
gtctcggcgtacgagccgtatatcgcactggcggaaaagctgaacgcgctggccccgttc
gaaggcccggccaagaccattttcttctccaccgggggggaagcgaccgaaaacgcggtc
aagatcgcgcgcgcggccaccgggcgcaacggcatcatcgcctttaccggcgggttccat
ggccgcacgctgctggcatcggccatgacgggcaaggtcaagccgtacaaggccccgttc
ggcaccctgccgggcgaagtctaccacctgcccttcccggatggggaagaggtgcaggtg
gctgacacgctgcgcatgctggacttcctgttcgccgccgacctgccggcatccagcgtc
gccgccatcatcatcgaacccgtgcagggtgaaggcggcttccgcgtggcgcccaccgaa
ctgctggtcgccctgcgccgcatctgtgacgaacacggcatcaagctggtggccgacgaa
gtgcagagcggcttcgcccgcacgggccgcctgttcggcatcgagcattccggcgtgcag
cccgatctggtctcggtcgcgaagtccatgggcggcggcctgccgctttcgggcgtgatc
gggcgcgcggaactcatggacgcggttggccccggtggccttggcggcacctatggcggc
gcgccgctggcctgcgccgcgggcctggccgtgctggacatcatccgcgacgaaaagctg
gtggaacgcgccaacacgattggtgaaaacctgcgtcgccacatcgaccgcctgcacgcc
aacaggaaactgctgcccgtcagccgcgcgcgtgggctgggggcgatgattgccttcgac
atcctggaagaacatggcaagccgggcgttcgcgcgggtgcggcggcggccatctgcgcg
cgggcgtgtgaaaaggggctgatcctgctgtcatgtggcacgcagggggcaaccatccgt
atcctggtaccattgacggcatcggatgcaatcattgatgaagggatgaacatcatcgaa
caggtcctggcagaatccgcagcctga

DBGET integrated database retrieval system