KEGG   Komagataeibacter xylinus: H845_1267Help
Entry
H845_1267         CDS       T03044                                 

Definition
(GenBank) Phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
gxl  Komagataeibacter xylinus
Brite
KEGG Orthology (KO) [BR:gxl00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    H845_1267
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 LMBR1 EpuA MFS_MOT1
Motif
Other DBs
NCBI-ProteinID: AHI25212
UniProt: W5Y7I5
Position
complement(1387324..1388679)
Genome map
AA seq 451 aa AA seqDB search
MLHFAPYSAFSIIALVICFALVCIFEFVNGFHDTANAVATVIYTRSLKPRTAVIWSGCMN
FIGVLLGGISVAYGLVELLPADVLSPPNGDPAVPMLISLFGTALAWNLFTWWFGIPNSSS
HCVIGALIGIAIGDALLHTRDLGNSVDWSQIWKILRALAISPLLGLVGAGGLYFVIKHLV
HDPELYQPPQGDRPTRGWVRGLLILTCTGVSFSHGSNDGQKSIGLIMLTIIGILPATFAL
APDSAPHIPHIAEYATSAAPLIDQYDHDGLRDEALAAVGRLSRTDAEHVVPSVLRADMYE
VVAGLKAVSANPAASTHERAQAKVLGNQMRPVVEYAPWWVRLLSALCLGIGTMIGYKRIV
HTLGEKIGNTHLTPAQGASAELVGAGLIATAGYTGLPVSTTHIITAGIAGTMLGSGSGIN
RGMLVKIALAWVCTLPVTITIAAGLFYILNA
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgctccacttcgcgccatattcagctttttccatcatcgcactggtcatatgcttcgca
cttgtctgcatctttgaattcgtaaacggattccatgatacagccaatgccgtcgcgacc
gttatctatacccgatcactcaagccccgtaccgccgtcatctggtcggggtgcatgaat
tttatcggcgtgctgctggggggcatcagcgtagcctacgggctggttgaactgctgccg
gcggatgtcctttcaccacccaacggcgacccggccgtgccgatgctgatttcactgttt
ggtacggcgctggcgtggaacctgtttacgtggtggtttggcatcccgaactccagttcc
cactgcgtcatcggcgcgctgatcggaattgccatcggggatgcgctgctgcatacgcgc
gacctgggcaacagcgttgactggtcacagatctggaagatcctgcgcgccctggccatt
tcgcccctgctggggctggttggcgcgggcgggctgtatttcgtcatcaagcacctggtt
catgatcccgaactgtaccagccgccgcagggtgacaggccgacacgtggctgggtccgt
ggcctgctgatcctgacgtgcaccggcgtcagcttttcccacggcagcaatgacgggcag
aaaagcattggcctgatcatgctgaccatcatcggcatcctgcccgcgacctttgccctg
gctcccgacagtgcgccgcatatcccccatatcgcggaatacgcgaccagtgccgccccc
ctgatcgatcagtacgaccatgacggcctgcgtgacgaagcgcttgccgcagtgggtcgc
ctgtcccggaccgatgcggaacatgttgtcccctctgtcctgcgcgcggacatgtatgaa
gttgtcgcgggcctgaaggccgtgtccgccaatcctgccgcctcaacccacgaacgggca
caggcgaaggtgctgggcaaccagatgcgccccgtggtggaatacgcgccatggtgggta
cgcctgctcagcgcgctgtgcctggggatcggcaccatgatcggttacaagcggatcgtg
catacgctgggtgaaaagatcggtaatacgcacctgaccccggcgcagggggcatcagcc
gaactggtgggcgcgggcctgatcgcaacggcgggctataccggcctgccggtcagcacg
acacatatcattaccgccggtatcgcgggcaccatgctggggtccggttcgggcatcaac
cgtggcatgctggtcaagattgccctggcgtgggtctgcaccctgccggtgaccattacg
atcgcggccgggctgttctatattcttaatgcctga

DBGET integrated database retrieval system