KEGG   Komagataeibacter xylinus: H845_1899Help
Entry
H845_1899         CDS       T03044                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
gxl  Komagataeibacter xylinus
Pathway
gxl00010  Glycolysis / Gluconeogenesis
gxl00020  Citrate cycle (TCA cycle)
gxl00620  Pyruvate metabolism
gxl01100  Metabolic pathways
gxl01110  Biosynthesis of secondary metabolites
gxl01120  Microbial metabolism in diverse environments
gxl01130  Biosynthesis of antibiotics
gxl01200  Carbon metabolism
Module
gxl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:gxl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    H845_1899
   00020 Citrate cycle (TCA cycle)
    H845_1899
   00620 Pyruvate metabolism
    H845_1899
Enzymes [BR:gxl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     H845_1899
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 DUF3614
Motif
Other DBs
NCBI-ProteinID: AHI25838
UniProt: W5YGZ6
Position
complement(2040622..2041896)
Genome map
AA seq 424 aa AA seqDB search
MSINILMPALSPTMKEGKLARWLKAEGDAIAAGDVIAEIETDKATMEVEAVDEGVLGRIL
IPEGTEGIAVNTPIGILVAEGESVPAAASAPAAQAAAPAASPASTPASAPAPAPQAARAA
APATTGKRVFASPLARRIATQKGIDLSTLKGSGPNGRIVRRDVEQAATAPAAPAPAPAPQ
PATPPAAPVAAGAGYESVPHSTMRRVIARRLTEAKTTVPHFYVEMDVQLDALMALRKQLN
AASPAEGPGAYKISVNDMLVKAAALTLRRVPKVNVAYSDDATLVFDDVDISVAVSIPDGL
ITPIVRRADTKGLRQISTEIRDLATRARAGRLKPEEFQGGTFSISNMGMYGVKAFSAILN
PPQAGILAIAAGERRPVVKGDDITIATVMTVTLSVDHRVVDGALAAEWVSAFRDVVENPM
SLVV
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgtccatcaacatcctgatgcccgccctgtcgcccaccatgaaggaaggcaagctggcg
cgctggctcaaggcggaaggtgacgcgatcgccgcaggcgacgtgattgccgaaatcgag
accgacaaggccacgatggaagtcgaggccgtggatgaaggcgtgctgggccgtatcctg
atcccggaagggacggagggcatagccgtcaacacccccatcggcatactggtggccgaa
ggcgaaagcgtgcccgccgccgcatccgcccctgcggcacaggcggcggcaccggcggcc
agcccggcatccacaccggcatccgccccggcccccgcgccgcaggccgcgcgcgccgcc
gccccggcaaccacggggaagcgggtatttgcctctccgctggcgcgccggatcgcgacg
cagaaaggcattgacctgtccacgctgaagggcagcggccccaacgggcgcatcgtgcgc
cgggacgtggaacaggccgccaccgcaccagcggccccggccccggcccccgcaccgcaa
cccgcaaccccgccagcggcccccgtggcggccggcgccgggtatgaaagcgtgccgcat
tccaccatgcgcagggtgatcgcgcgcaggctgacggaagccaagaccaccgtcccgcat
ttctatgtggaaatggatgtgcagcttgacgcgctgatggcgctgcgcaagcagttgaac
gccgcatccccggccgagggaccgggcgcgtacaagatttccgtcaacgacatgctggtg
aaggcagccgcgcttacgctgcgccgcgtgccgaaggtcaacgtggcctacagcgatgac
gcgacgctggtttttgatgacgtggatatttccgtcgccgtttccatccccgacgggctg
atcacgcccatcgtgcgccgcgccgataccaagggcctgcgccagatcagcaccgaaatc
cgcgacctggccacccgggcgcgggcgggcaggctgaagccggaggaattccagggcggc
acgttctccatctccaacatggggatgtacggggtcaaggcgttttccgccatcctcaac
ccgccacaggccgggatactcgccatcgcggcgggggaacgcaggccggtggtgaagggg
gatgacatcaccatcgccaccgtcatgaccgtgaccctgtcggttgaccaccgcgtggtg
gatggcgcgctggcggcggaatgggtttcggccttccgcgacgtggttgaaaaccccatg
agccttgtggtctga

DBGET integrated database retrieval system