KEGG   Komagataeibacter xylinus: H845_638Help
Entry
H845_638          CDS       T03044                                 

Definition
(GenBank) putative glutamyl-tRNA(Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
gxl  Komagataeibacter xylinus
Pathway
gxl00970  Aminoacyl-tRNA biosynthesis
gxl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gxl00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    H845_638
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:gxl03029]
    H845_638
Enzymes [BR:gxl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     H845_638
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     H845_638
Mitochondrial biogenesis [BR:gxl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    H845_638
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AHI24596
UniProt: W5Y5Q7
Position
693974..695347
Genome map
AA seq 457 aa AA seqDB search
MTIQGHKAGAALAIAADVRAGRRSAVSVVTDVIADIEARDTRFNSVTRILGPAAVAQAEE
VDRAIAAGRDPGPLAGVPFGVKDLFDVRGEVTTAGSIVLRDNLPATRDAVVVERLRTAGA
VPVATLNMDEFAYGFSTENAHTGTTRNPHDTARLAGGSSGGSAASVAAGLLPFTLGSDTN
GSIRIPSSLCGVWGLKPTYGQMPLGGVYPFVASLDVVGPMADTVDDLRAVYTIMAGGTPV
GEPDISDVRVARLGGWFADNISTELRAGIDAVMAHLGQDRVIELPEVARARASAFLISAA
EGGNLHLPRLRRRSMQYDPATRGRLMAGAMLPAATFVQAQRFRRWFRDHVHAALAQADVL
VAPATVGVAPRIDQPSIVVDGKTVSARANLGIFTQPISLAGLPVLAAPLAVDGLPLGIQL
IGAPGGEAKLFAVAAELQRAGLAACRPLEAGYARKDS
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgaccattcaggggcacaaggcgggtgcggcccttgccattgcggcggatgtgcgcgca
ggccgccgcagcgctgtatcggtcgtaacggatgtgatcgcggatattgaagcccgtgac
acgcgcttcaacagcgtcacccgcatccttggccccgccgccgtggcgcaggccgaggaa
gtggacagggccattgccgccggtcgcgatcccggcccgctggcgggcgtgcccttcggg
gtgaaggacctgtttgacgtccggggtgaagtgaccacggcggggtccatcgtgctgcgt
gacaacctgcccgccacgcgcgacgcggttgttgtcgaacgcctgcggaccgcgggcgcg
gtgccggtcgcgaccctgaacatggatgaattcgcctacggcttttccaccgaaaacgcc
cataccggcacaacgcgcaacccgcatgataccgcgcgcctggccggtggctcatcgggt
gggtcggcggcgtcggtcgcggcgggcctgctgccgttcacgctggggtcggacaccaac
gggtccatccgcatcccgtcctccctgtgcggggtgtgggggctgaagccgacctacggg
cagatgccgctgggcggcgtctatccgttcgtggccagcctggatgtggttggcccgatg
gcggatacggtggatgacctgcgggcggtctacaccatcatggccggtggcacgccggtg
ggcgaacccgatataagcgatgtgcgcgtggcccgccttggcggctggtttgcagacaat
atcagcacggaactgcgcgcgggcattgacgccgtcatggcgcatctgggccaggaccgt
gtgatcgaactgccggaagtcgcgcgtgcgcgggcttcggccttcctgatcagcgcggcg
gaagggggcaacctgcacctgccacgcctgcggcggcggtccatgcagtatgatcccgcg
acacgcgggcggcttatggccggggccatgctgcctgcggcgacattcgtgcaggcgcag
cgtttccgccgctggttccgtgaccatgtgcatgccgccctggcccaggccgatgtgctg
gtggctcccgccacggtgggtgtcgcgccgcgtattgaccagccctccatcgtggtggat
ggcaaaacggtttccgcccgcgcgaaccttggcatcttcacgcagccgatcagccttgcc
ggcctgccggtgctggcggccccgctggcggtggatggcctgccgctgggcatccagttg
atcggcgcgccggggggggaagcgaagctgtttgccgtcgcagccgaactgcagcgcgcg
gggcttgcggcctgccgcccccttgaggctggatacgcacggaaggacagctga

DBGET integrated database retrieval system