KEGG   Komagataeibacter medellinensis: GLX_05640Help
Entry
GLX_05640         CDS       T01631                                 

Definition
(GenBank) phosphomanno mutase
  KO
K01840  phosphomannomutase [EC:5.4.2.8]
Organism
gxy  Komagataeibacter medellinensis
Pathway
gxy00051  Fructose and mannose metabolism
gxy00520  Amino sugar and nucleotide sugar metabolism
gxy01100  Metabolic pathways
gxy01110  Biosynthesis of secondary metabolites
gxy01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:gxy00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    GLX_05640
   00520 Amino sugar and nucleotide sugar metabolism
    GLX_05640
Enzymes [BR:gxy01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.8  phosphomannomutase
     GLX_05640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: BAK82976
UniProt: G2I4C9
Position
658308..659714
Genome map
AA seq 468 aa AA seqDB search
MTFQHRFDPSTLREYDIRGVVGTTLGPEDAYAIGRTFGSMVARAGGQRLIIGRDGRLSSP
SLEQALVEGAVASGMAVQRIGCGPTPMLYFASVAFGADGAIMVTGSHNPPDHNGFKILQA
NQPFFGPQVRELGRLSAMGDVVPHNPGTTQDVDIRPDYVARLLRDYDDGPRPLKVVWDNA
SSAAGDVLSMVVQRLPGTHHILNGTIDGHFPAHHPDPTIPANMRQLADAVRMEKADLGLA
FDGDADRLGVVDDTGTMIWADQLLVLVARDVLRARPGATVIADVKASQILFDEIARAGGR
PLMWKSGHSPIKTKMAETRAPLAGEMSGHFFFADRWYGFDDGLYAAIRLLGIVSRLSQPL
SAIRAALPATLSTPELRFDCPETRKFGVIAEVASRLEKTGATVCAIDGVRVSTGEGWWLL
RASNTQALLVARVEGATQAALERLKAELCAQLALSGIAAPDFSGARSD
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgaccttccagcaccggttcgatccctccaccctgcgggaatatgacatccgcggggtt
gtgggaacaacccttggcccggaagacgcctatgccatcggccgcaccttcggcagcatg
gtggcacgggcgggtggtcagcgccttatcatcggtcgtgacgggcggctttcttctcct
tcccttgagcaagcgcttgtggaaggggcggtggcatctggcatggcggtgcagcgtatt
ggctgcgggccaacgcccatgctgtatttcgcctcggtcgcctttggggccgacggggca
atcatggttacgggtagccataaccccccagaccataatggcttcaagatcctgcaggcc
aaccagcctttctttggcccgcaggtcagagaactggggcgactgtccgccatgggcgat
gtcgtgccgcacaaccccggcaccacgcaggatgtggacataaggcccgattatgtcgcg
cgcctcctgcgcgattacgatgatggcccgcgcccgctgaaagtggtgtgggataatgcc
agcagtgcggcaggcgatgtcctttccatggtcgtgcaaagacttcccggcacgcaccat
atcctcaacggcacgatcgacggccattttcccgcacatcaccccgatcccaccattcct
gccaacatgcgccagttggccgatgccgtacggatggaaaaggcagaccttggcctggcg
ttcgatggcgatgccgaccgtctgggcgtggtggatgatacaggcaccatgatatgggcc
gaccagttgctggtgcttgtggcgcgcgacgtgctgcgtgcccggccgggggccacggtc
attgccgatgtcaaggcaagccagatcctgtttgatgagattgcacgcgcaggcggcagg
ccgctcatgtggaaatctggccattcccccatcaagaccaagatggccgagacgcgcgcc
ccgttagcgggcgaaatgtcgggccatttcttttttgccgacaggtggtacggatttgat
gacgggctttatgccgccatccggctgctgggcattgtctcgcgcctgtcacaaccgcta
tcggccatacgtgcggcactccctgccacgctgtccacacccgaactgcgttttgactgc
cccgaaacacgcaaattcggcgtaattgcggaagttgcctcccgtctggaaaaaaccgga
gccacggtctgcgccattgatggcgtgcgtgtctcgacaggggaggggtggtggctgctg
cgcgcctccaacacgcaggcccttctggtcgcgcgggtggaaggagccacgcaggccgcg
ctggaacggctcaaggcggaactctgtgcccagcttgcattgtcgggcattgccgcgcct
gatttttccggggcgagaagcgactga

DBGET integrated database retrieval system