KEGG   Komagataeibacter medellinensis: GLX_07540Help
Entry
GLX_07540         CDS       T01631                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase component (E2) of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
gxy  Komagataeibacter medellinensis
Pathway
gxy00010  Glycolysis / Gluconeogenesis
gxy00020  Citrate cycle (TCA cycle)
gxy00620  Pyruvate metabolism
gxy01100  Metabolic pathways
gxy01110  Biosynthesis of secondary metabolites
gxy01120  Microbial metabolism in diverse environments
gxy01130  Biosynthesis of antibiotics
gxy01200  Carbon metabolism
Module
gxy_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:gxy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GLX_07540
   00020 Citrate cycle (TCA cycle)
    GLX_07540
   00620 Pyruvate metabolism
    GLX_07540
Enzymes [BR:gxy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     GLX_07540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: BAK83166
UniProt: G2I4W9
Position
complement(860939..862207)
Genome map
AA seq 422 aa AA seqDB search
MPINILMPALSPTMKEGTLARWLKAEGDAIAAGDVIAEIETDKATMEVEAVDEGVLGRIL
IGEGTDGIAVNTPIAILVAEGESVPDAPAAPATAPAMAAPAPVPAQAVPTPQAPAASAAP
MAKGARVFASPLARRIAAQTGIDLATLRGSGPNGRIVRRDVEQARQTPAATPAATVAQAA
PAAAPAAPAGAAYDSVPHSGMRKVIARRLTEAKSTIPHFYVEMDVELDALLALRSQLNAA
APDEGPGAYKISVNDMLVKAAAVTLRRVPQVNVSYTDDAVLAYHDVDISVAVSIPDGLIT
PIVRAADTKGLRQISLETRDLVARARTGKLKPEEFQGGTFSISNMGMYGVKAFSAILNPP
QAAILAIAAGERRAVVKGSEIVIATVMTVTLSVDHRVVDGALAAQWLSAFRTVVENPMSL
VV
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcaacatcctgatgccagcgctttcccccaccatgaaggaaggcacgctggca
cgctggctcaaggcggaaggtgacgccattgcagcgggcgacgtgattgcggaaatcgag
accgacaaggccacgatggaagtcgaggccgtggatgaaggcgtgctgggccgtatcctg
attggcgagggcacggacgggattgccgtcaacacccccatcgccatactggtagccgaa
ggggaaagcgtgcccgacgcgcctgccgcccccgcaaccgccccggccatggcggccccg
gcgcccgtacctgcgcaggccgtcccgaccccgcaggcccctgccgcatcagccgcacct
atggcaaagggcgcacgcgtgtttgcttcccctcttgcgcgccgcattgcagcccagacg
ggcatcgaccttgccacgctcaggggcagcggccccaacgggcgcatcgtgcgccgtgat
gtggagcaggcgcggcagaccccggccgctacacccgctgccaccgtggcgcaggcggcc
cctgccgccgctcctgctgctcctgccggtgcggcatatgacagtgtgccgcattcgggc
atgcgcaaggtgattgcgcgccgcctgacggaagccaagtccaccatcccgcatttttat
gtggaaatggatgtggaactggacgcgctgctggccctgcgcagccagcttaatgcagcc
gcccctgatgaagggccgggtgcgtacaagatctcggtcaatgacatgctggtcaaggcg
gcggcggtgaccctgcgccgcgtgccgcaggtcaatgtgtcctataccgatgatgcggtg
ctggcgtatcatgatgtggatatttctgttgccgtctccatccccgacgggctgatcacc
cccatcgtgcgcgcggccgacaccaagggcctgcgccagatcagccttgagacacgcgac
cttgtggcgcgcgcgcggacaggcaagctgaagccggaggaattccagggcggcaccttc
tccatctccaatatggggatgtatggggtcaaggcgttctccgccatcctcaacccgcca
caggcggccatcctggccattgcggcgggtgagcgcagggcggtggtcaagggcagcgag
attgtcattgccacggtcatgacggtcacgctttcggtcgatcaccgggtggtggatggg
gcgctggccgcacagtggctttcggccttccgtacggttgttgaaaacccgatgagcctt
gtggtctga

DBGET integrated database retrieval system