KEGG   Komagataeibacter medellinensis: GLX_10620Help
Entry
GLX_10620         CDS       T01631                                 

Definition
(GenBank) LSU ribosomal protein L22P
  KO
K02890  large subunit ribosomal protein L22
Organism
gxy  Komagataeibacter medellinensis
Pathway
gxy03010  Ribosome
Brite
KEGG Orthology (KO) [BR:gxy00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    GLX_10620
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:gxy03011]
    GLX_10620
Ribosome [BR:gxy03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    GLX_10620
  Bacteria
    GLX_10620
  Archaea
    GLX_10620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 TniB KORA Gag_spuma
Motif
Other DBs
NCBI-ProteinID: BAK83474
UniProt: G2I5S7
Position
complement(1216058..1216459)
Genome map
AA seq 133 aa AA seqDB search
MSKPKHPRTLAETEAQALTRNIRISPRKLNLVAGLIRNKPAAQAIATLTFSKRRIAQQVK
KTLESAIANAENNHQLDVDQLIVARAEVGKSIVMRRFHARGRGRSARIEKFFSHLTIVVA
EKKPEAETEKKAA
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagcctaagcatccgcgtacgctcgcggaaaccgaggcgcaggcgctgacgcgg
aacatccgcatcagcccgcgcaagctgaatcttgttgcgggtctgatccgcaacaagccg
gctgcgcaggcaatcgccaccctcacattctccaagcgtcgtattgcccagcaggttaag
aagaccctggaaagtgcgattgccaatgccgagaataaccatcagcttgatgttgatcag
ctgattgttgcccgtgcagaggtaggtaagtcgatcgtgatgcgtcgtttccacgcacgt
ggtcgtggccgttcggcccgcatcgagaagttcttcagccacctgaccatcgttgtggcg
gaaaagaagcccgaagctgaaaccgaaaagaaggcggcctga

DBGET integrated database retrieval system