KEGG   Komagataeibacter medellinensis: GLX_13600Help
Entry
GLX_13600         CDS       T01631                                 

Definition
(GenBank) protein apaG
  KO
K06195  ApaG protein
Organism
gxy  Komagataeibacter medellinensis
Brite
KEGG Orthology (KO) [BR:gxy00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    GLX_13600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: BAK83772
UniProt: G2I6M5
Position
1559337..1559813
Genome map
AA seq 158 aa AA seqDB search
MSKNRHFPPPGGEGADSPPGVSMDNVPCFEAMTDGVRVVVQTFWLDDQSEPDEHRYVWAY
RVRIENHGTEQIQLLRRSWRIVDGQGRIDRVDGEGVVGEQPLIDASGSFEYMSGAALETP
TGFMGGMYHMIRPASRQHFDVSIPVFSLDSPHHPAILH
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaacaggcattttcctccccccggcggggaaggggcggattctccgccgggc
gtgtcaatggataatgtcccctgtttcgaggcaatgacggacggcgtccgtgttgttgtc
cagactttctggcttgatgaccagtccgaacctgatgagcaccgctatgtgtgggcctat
cgggtacggatcgaaaaccacggcaccgaacagatccagctcctgcgtcgcagttggcgc
atcgtggacgggcagggccggatcgaccgggtggatggcgaaggtgtggtgggcgaacaa
ccactgatcgacgccagtggcagttttgaatacatgtcaggcgccgcactggaaacgccg
actggcttcatgggcggcatgtatcacatgatccgcccggccagccggcagcattttgat
gtcagcattcccgtcttcagcctggatagcccccaccacccggccatcctgcattag

DBGET integrated database retrieval system