KEGG   Komagataeibacter medellinensis: GLX_21160Help
Entry
GLX_21160         CDS       T01631                                 

Definition
(GenBank) lipopolysaccharide biogenesis periplasmic protein
  KO
K07290  AsmA family protein
Organism
gxy  Komagataeibacter medellinensis
Brite
KEGG Orthology (KO) [BR:gxy00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    GLX_21160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AsmA AsmA_2 DctA-YdbH
Motif
Other DBs
NCBI-ProteinID: BAK84528
UniProt: G2I0S0
Position
2351687..2353828
Genome map
AA seq 713 aa AA seqDB search
MPQPAKPDSPPRRNLLAQIRFPFLGVLVVGVLALVIFWSWDWFIPMVERRAGAALGRKVT
LAHLHVHVGRVIRITADEVKIDEPEGFATLPPFATADHLMVGVRLWPLLGGKLDLPVIAL
DKPVVELNEKRDGTANYQFPASGGGGSTAMPRIGELNIDAGQLHLVHAGLRSNMRAEVHT
TPGQGDVQPRIVADVRGTYTGQAIIGHFSGGALVSLADRTRPYPVDVDVRHGPTRLTLVG
TVDDPLSFAGTRLRLTLAGPDMSLLYPLTGVVIPQTPAYHVAGSLDYHDGRVRFRNFEGV
VGSSDLGGTLDVDPHQSVTFVDTNLHSRHVDLADLGGFFGATPGEHPSTTQQAAQEKVHQ
ASGAVLPSTPINMPRLKATNVHLAYHGDHIENRHTPLDNIDVLADIRDGTIDVHHLNFAV
GKGTLASSGTFVPQGNGMDARIRIDMEQIDLARLMQAMGHNLHGQGIIGGHIVVHGHGQS
LAQIVGNGDGGITMALDDGGDISAILPDLLGLELGKALLSALGLPARTDLKCLIADMPLQ
DGVFHTRTMLLETGDTRTVGSGDIRFSNNTIDYKLLTHSRHFAIASFPGPLYITGPLKSP
NVRPGAEIIGRAVASVLTGFVFSPVGLLPTIEGGVGKNSSCASAIREVNDNPAAGIAPHA
SHPGRHGAHGHGVSARQGAAASKAGASNIGPNGLSAAERARIRAVWAGKMATH
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atgccacagcccgcaaagcctgatagcccgcctcgtcgtaatttactggcgcagatccgt
tttccgttcctgggtgtgctggtggtgggtgtgctggcgctggtcatattctggtcgtgg
gactggttcatccccatggtggaacgccgcgccggcgcggcgctggggcgtaaggtaacg
cttgcgcacctgcatgtgcatgttggccgcgtgatccgtatcacggccgatgaggtgaag
attgacgaacccgagggtttcgccaccctgccgccctttgccaccgccgaccatctgatg
gtgggggtccgcctgtggcccctgctgggcgggaagctggacctgccggtcattgcgctg
gacaaaccggtggttgaactgaacgaaaagcgtgacggtaccgccaactatcagtttccc
gccagtggtggcggtggttcgaccgccatgccacgcattggcgagcttaatattgatgcg
ggccagcttcatcttgttcatgccgggctgcgcagcaacatgcgtgccgaggtgcatacc
acgccggggcagggagatgtgcaaccccggatcgtggcggatgtacgcggcacctatacc
gggcaggccatcatcgggcatttctcgggcggggcgctggtctcgctggctgacaggacc
aggccctacccggttgatgtagacgtgcgccacggccccacgcgcctgacactggtgggc
acggtggatgatccgctgtcttttgccggtacccggctcaggctgacgctggcggggccg
gacatgtcgctgctttatccgctgaccggcgtagtgatccctcagacccctgcctaccat
gtggcgggcagcctggactatcatgacgggcgggtgcgctttcgcaattttgaaggcgtg
gtcggctccagcgacctgggcggcacgctggatgtggacccgcaccagagtgtcacattc
gtggataccaacctgcattcacgccatgtggacctggcggaccttggcggtttctttggt
gcgacgccgggcgagcatccctccaccacccagcaggcggcgcaggaaaaggtgcatcag
gccagcggcgcggtgctgccctccacacccatcaacatgccccgcctcaaggccaccaat
gtccatcttgcctatcatggcgaccatatcgaaaaccggcataccccgctcgacaacatt
gatgtgctggcggatatccgcgatggcacgattgatgtccatcatctcaattttgccgtg
ggcaagggcacgctggccagcagtggcacctttgtgccgcagggcaatggcatggatgcg
cgcatccgtatcgacatggagcagatcgaccttgcccgtctgatgcaggcaatgggccac
aacctgcatgggcaggggatcattggcgggcatatcgtggtgcatggccatggccagtcg
ctggcgcagatcgtgggcaatggcgatggcggcattaccatggcgctggatgacggaggc
gacatttcggccatcctgcccgacctgctggggctggaactgggtaaagcgctgctttcc
gcacttggcctgcccgcacggactgacctgaaatgcctgattgccgacatgcccctgcag
gacggcgtgttccacacccgcaccatgctcctggaaacgggcgatacccgcaccgtgggc
agtggggacatccgcttcagtaacaataccatcgactataaactgcttacccattcacga
cattttgccatcgcgtcttttcccggcccgctttacatcactggaccgctcaagagtccg
aatgtcaggccgggggcggaaatcatcggtcgggccgtggcgtccgtgctgacgggtttc
gtgttctcgcccgtaggtctgctgcccaccattgaagggggcgtgggcaaaaattcatcg
tgcgccagcgccatccgggaggtgaatgacaacccggccgcaggcatcgccccccatgcc
agccatccgggacggcatggcgcgcacgggcatggcgtatctgcccggcagggtgcggcc
gccagcaaggcaggtgcgtccaacattggccccaacgggttgagtgccgccgagcgcgca
cgtatccgcgcagtctgggcaggcaagatggcaacacattga

DBGET integrated database retrieval system