KEGG   Komagataeibacter medellinensis: GLX_21790Help
Entry
GLX_21790         CDS       T01631                                 

Definition
(GenBank) alcohol dehydrogenase zinc-dependent
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
gxy  Komagataeibacter medellinensis
Pathway
gxy00010  Glycolysis / Gluconeogenesis
gxy00071  Fatty acid degradation
gxy00350  Tyrosine metabolism
gxy00625  Chloroalkane and chloroalkene degradation
gxy00626  Naphthalene degradation
gxy01100  Metabolic pathways
gxy01110  Biosynthesis of secondary metabolites
gxy01120  Microbial metabolism in diverse environments
gxy01130  Biosynthesis of antibiotics
gxy01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gxy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GLX_21790
  Lipid metabolism
   00071 Fatty acid degradation
    GLX_21790
  Amino acid metabolism
   00350 Tyrosine metabolism
    GLX_21790
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    GLX_21790
   00626 Naphthalene degradation
    GLX_21790
Enzymes [BR:gxy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     GLX_21790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N F420_oxidored
Motif
Other DBs
NCBI-ProteinID: BAK84591
UniProt: G2I0Y3
Position
complement(2408965..2409951)
Genome map
AA seq 328 aa AA seqDB search
MYAMRLLAPHTPLQWTELPDPQPGPGQIRVKVGACGVCRTDLHVVDADLPFPGHALTPGH
EIVGRIDALGPNVEGLHMGQRVGIPWLGHTCGCCHYCETDHENLCDHPLFTGYTRDGGYA
TLAVADAHFAFPLPEGDDDVATAPLLCAGLIGWRSLVMAGKEARSIGLYGFGAAAHIIAQ
VAVWQGRSVYAFTRPGDTKTQEFARSLGCTWAGGSDEAPPEQLDATIIFAPVGALVPAAL
KAVHKAGRVVCAGIHMSEIPAFSYDLLWEERQIVSVANLTRQDGLDFLEIVPRVGIRTTT
TPYPLRDANKALDDLRHGRFEGAAVLVP
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtacgcaatgcggctgcttgccccccatacccccctgcaatggaccgaactgcccgac
ccgcagccggggccggggcagatccgggtcaaggtcggggcgtgcggcgtatgccgcacc
gacctgcatgtggtggatgccgatctgccctttcccggtcacgccctgacaccggggcac
gagatcgtgggccggatcgacgcgcttggtccgaatgtggaggggctgcacatgggccag
cgcgtgggcattccatggctgggccacacctgcggctgctgccactactgcgaaaccgac
cacgagaacctgtgcgaccacccgctgttcaccggctacacgcgcgatggcggttacgcc
acgctggcggtggcggacgcgcattttgccttccccctgcccgaaggcgatgacgacgtg
gccaccgcccccctgctgtgcgcgggactgatcggctggcgctcgctggtcatggcgggc
aaggaggcacgcagcatcgggctttacggctttggggccgcagcccatatcattgcacag
gtggcggtgtggcaggggcgttcggtctatgccttcacccgtcctggcgatacgaaaaca
caggaattcgcccgctccctgggctgcacatgggctggcggatcggatgaagccccaccc
gaacaactggacgccaccatcatcttcgcccccgtgggcgcgctggtacctgcggcgctg
aaggccgtgcacaaggccgggcgcgtggtatgcgcgggcatccatatgagtgaaatcccc
gctttttcgtatgacctgctgtgggaggaacgccagattgtatcggtcgccaacctgacg
cgacaggacgggctggactttctggaaatcgtgccacgggtgggaatccgcacgacaaca
accccctatcccctgcgtgatgccaacaaggcactggatgacctgcgccatggtcgcttt
gaaggggcggccgttctggtgccctga

DBGET integrated database retrieval system