KEGG   Komagataeibacter medellinensis: GLX_28010Help
Entry
GLX_28010         CDS       T01631                                 

Definition
(GenBank) protein-L-isoaspartate (D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
gxy  Komagataeibacter medellinensis
Brite
Enzymes [BR:gxy01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     GLX_28010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 RrnaAD MTS Methyltransf_11 Methyltransf_32 Methyltransf_12 AlaDh_PNT_C Gcd10p Methyltransf_23
Motif
Other DBs
NCBI-ProteinID: BAK85213
UniProt: G2I3P6
Position
3123937..3124641
Genome map
AA seq 234 aa AA seqDB search
MLQGNVMDKTDPDYAPLDPVAARQRMVDAQIRPAQVSNPAVIAAMRAVPREDAVPPALRA
FAYADQNLPLGEGRYLTEPRVTGRMLQVADIQPGERILVVGAGTGYLAALLSAMGQGLAV
TALESESRLADLGQVLCHQQAPDVQWRNGPLIKGDEADGPYDLILVDGAVRQVPPALVAQ
LAKGGRVVAPICPVGGVTSVCLVLPTAQGGAVQRLFDAAVPLLPELEPAPAFVF
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgcttcaaggaaatgttatggacaagacagaccccgattatgccccgcttgatcccgtg
gccgcccggcagcgtatggtggatgcacagatccgcccggcacaggtcagcaatccggcc
gtgatcgccgccatgcgggcagtaccgcgtgaggatgcggtaccgcctgcgctgcgagcc
tttgcctatgccgaccagaatctgccgctgggcgaggggcgttacctgaccgaaccccgc
gtaacgggccgtatgctgcaggtggccgatatccagcccggggagcggattctggtcgtg
ggtgcgggcacgggttatctggcggcactgctgtccgccatggggcaggggcttgctgtt
acggcgctggaatcagaatcgcgtctggcggatctggggcaggttctgtgccaccagcag
gcacccgatgtgcagtggcgcaacgggccactgataaagggggatgaagcagatggtccc
tatgacctgatccttgttgacggcgcggtgcgccaggttcccccggcgcttgtggcgcaa
ttggccaaaggagggcgcgttgtcgcccccatctgcccggttggtggtgtgacatcggtc
tgtcttgtcctgcccacggcgcaggggggggccgtacaacggctgtttgatgctgccgta
cccctcctgccggaactggaaccggccccggctttcgtgttctga

DBGET integrated database retrieval system