KEGG   Geobacillus sp. Y412MC52: GYMC52_0039Help
Entry
GYMC52_0039       CDS       T01399                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
gya00900  Terpenoid backbone biosynthesis
gya01100  Metabolic pathways
gya01110  Biosynthesis of secondary metabolites
gya01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:gya00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GYMC52_0039
Enzymes [BR:gya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     GYMC52_0039
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ADU92554
UniProt: A0A0E0T774
Position
52116..52988
Genome map
AA seq 290 aa AA seqDB search
MRLSIKAPAKINLSLDVLYKRPDGYHEVKMVMTTIDLADRIELVALPEEDAIRIVSQNRF
VPDDCRNLAYQAAKLLKETFSIRQGVAISITKHIPVAAGLAGGSSDAAATLRGLNKLWQL
GLTLDELAELGAKIGSDVAFCVYGGTALATGRGEIITPIASPPPCWVVLAKPPIGVSTAE
VYRNLELERVSHPDVDAMVRAIERQDYAAICRLVGNVLEEVTLKKYPEVAHIKEQMKRFG
ADAVLMSGSGPTVFGLIEHDSRMQRVYNGLRGFCDQVFAVRLLGERHSLD
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
gtgaggttgtcgataaaagcgccggcgaaaatcaatttgtcactcgacgttctttataag
cgcccggatggttaccatgaagtgaaaatggtgatgacgacgatcgatttggccgatcgc
attgagcttgtcgcgttgccggaggaagatgcgatccgcatcgtttcgcaaaaccgcttt
gtgcccgatgattgccgcaacttggcgtatcaggcggcgaagcttcttaaagagacgttt
tcgatccgccaaggggtggccatttcgattacgaagcatattccggtggccgccggattg
gcgggaggaagcagcgatgcggcggcgacgctgcgcgggttgaacaagctttggcagctc
ggattgacgctcgatgaactggcagagcttggggcgaaaatcggttcggatgtcgctttt
tgcgtctacggcggaaccgccttggcgacggggcgcggggaaatcatcactccgatcgct
tcaccgccgccgtgctgggttgtgctggccaagcccccgattggtgtatcgacggcggaa
gtgtaccgaaacttggaacttgagcgtgtcagccatccggatgtcgatgcgatggtgaga
gcgatcgagcggcaagattatgcggcgatctgccggttggtcggcaacgttcttgaggaa
gtgacgttgaaaaaatatccagaagttgcgcatattaaggaacaaatgaagcggtttggc
gctgatgcggtgctgatgagcggcagcgggccgaccgtgtttggactgatcgagcatgat
tcgagaatgcaacgggtgtacaacgggttgcgcggcttttgcgaccaagtatttgcggtg
aggctattgggggaacgccattctcttgattaa

DBGET integrated database retrieval system