KEGG   Geobacillus sp. Y412MC52: GYMC52_0149Help
Entry
GYMC52_0149       CDS       T01399                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
gya00220  Arginine biosynthesis
gya00330  Arginine and proline metabolism
gya01100  Metabolic pathways
gya01110  Biosynthesis of secondary metabolites
gya01130  Biosynthesis of antibiotics
gya01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gya00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    GYMC52_0149
   00330 Arginine and proline metabolism
    GYMC52_0149
Enzymes [BR:gya01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     GYMC52_0149
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ADU92664
UniProt: A0A0E0T7I1
Position
161709..162608
Genome map
AA seq 299 aa AA seqDB search
MKPISIIGVPMDLGQTRRGVDMGPSAMRYAGVIERLEHLHYDIEDLGDIPIGKAERLHEQ
GDSRLRNLKAVAEANEKLAAAVDQVVQRGRFPLVLGGDHSIAIGTLAGVAKHYERLGVIW
YDAHGDVNTEETSPSGNIHGMPLAASLGFGHPALTQIGGYSPKIKPEHVVLIGVRSLDEG
EKKFIREKGIKIYTMHEVDRLGMTRVMEETITYLKERTDGVHLSLDLDGLDPSDAPGVGT
PVIGGLTYRESHLAMEMLAEAQIITSAEFVEVNPILDERNKTASVAVALMGSLFGEKLI
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaagccaatttcaattatcggggttccgatggatttagggcagacacgccgcggcgtt
gatatggggccgagcgcaatgcgttatgcaggcgtcatcgaacgtctggaacatcttcat
tacgatattgaagatttgggagatattccgattgggaaagcagagcggttgcacgagcaa
ggagattcacggttgcgcaatttgaaagcggttgcggaggcgaatgagaaactcgcggcg
gcggttgaccaagtcgttcagcgggggcgcttcccacttgtgctgggcggcgaccatagc
atcgccattggcacgctcgccggggtggcgaaacattatgagcggcttggagtgatctgg
tatgacgcgcacggcgacgtcaacaccgaggaaacgtcgccgtctggaaacattcatggc
atgccgctggcggcgagcctcgggtttggccatccggcgctgacgcaaatcggcggatac
agccccaaaatcaagccggaacatgtcgtgttgatcggcgtccgttcccttgatgaaggg
gagaagaagtttattcgcgaaaaaggaatcaaaatttacacgatgcatgaggttgatcgg
ctcggaatgacaagggtgatggaagaaacgatcacctatttaaaagaacgaacggatggc
gttcatttgtcgcttgacttggatggccttgacccaagcgacgcaccgggagtcggaacg
cctgtcattggaggattgacataccgcgaaagccatttggcgatggagatgctggccgaa
gcacaaatcatcacttcagcggaatttgtcgaagtgaacccgatcttggatgagcggaac
aaaacagcatcagttgctgtagcgctgatggggtcgttgtttggtgaaaagctcatttaa

DBGET integrated database retrieval system