KEGG   Geobacillus sp. Y412MC52: GYMC52_0361Help
Entry
GYMC52_0361       CDS       T01399                                 

Definition
(GenBank) Nucleotidyl transferase
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
gya00051  Fructose and mannose metabolism
gya00520  Amino sugar and nucleotide sugar metabolism
gya01100  Metabolic pathways
gya01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gya00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    GYMC52_0361
   00520 Amino sugar and nucleotide sugar metabolism
    GYMC52_0361
Enzymes [BR:gya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     GYMC52_0361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Hexapep Hexapep_2
Motif
Other DBs
NCBI-ProteinID: ADU92863
UniProt: A0A0E0T855
Position
402427..403470
Genome map
AA seq 347 aa AA seqDB search
MKALLLAGGLGTRLRPLTENIPKPMAPIANRPWLEHLIVHLRDQGVNEFVIAAHHCSEVI
RRYFEDGKRWNVKITYALEPFPLGTAGAIKNAERWLKERFLVFNADIVHLPQLIPLLDFH
RQHGGLATIVLTEVDDPSSYGVVEQDDRGQILRFVEKPRREEAPSNRINAGMYIFEPDVM
RYIPAEREVSIERETFPLLIEKNVGVYGIVSNGYWRDMGTPARYRQVHWDALRREFPIPL
KGREIQPGVFVGENVEIGSGVLFVPPVLIGDHVKIGPQAVIGPNAVIGDRCQIGARVHCA
QTIVWDRSVIRDRSRLQNSIFGYRTVTPAGEVFEDSIINQFKEAVQA
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattgttgctggcaggaggattaggtacgcgtcttcgtccattgaccgaaaac
atccccaaaccgatggccccgattgcgaaccggccatggcttgaacacctcatcgttcat
cttcgcgaccaaggagtcaacgaatttgtcatcgccgcacatcattgttcagaagtgatc
cgtcgctatttcgaagatgggaagcgctggaacgtcaagattacatacgcgctcgaaccg
ttcccacttggaacggctggggcgatcaaaaacgccgagcgctggctgaaggaacggttt
ctcgtgtttaacgccgacattgtgcatttgccgcaattgatcccgctgcttgatttccat
cgtcaacatggcggtttggcgaccattgttttaacggaagtagacgatccttcttcctat
ggggtggtcgaacaagacgatcgtgggcaaattttacgctttgtcgaaaagccgcgccgc
gaagaagcgccatcgaaccgcatcaatgccggcatgtatattttcgagccggacgtgatg
cgctatattccggctgagcgggaagtatcgattgaacgcgaaacattcccgctgctgatc
gagaagaatgtcggtgtatatggcatcgtcagcaacggatactggcgtgatatggggacg
ccggcccgctaccgccaagttcactgggatgcgttgcgtcgggagtttccgattccgctc
aaaggacgtgaaattcaaccgggcgtgtttgtcggtgaaaacgtggagattgggtctggc
gttttgtttgtgccgcctgtgctcatcggcgaccacgtgaaaatcggtccgcaggctgtc
attggcccgaatgcggtcatcggcgaccgctgccaaattggcgcccgcgtccattgcgcg
cagacaatcgtttgggaccgctctgtcattcgtgaccgcagccgtttgcaaaacagcatt
ttcggctatcggacggtgacgccggcgggagaagtgttcgaagattcgattattaatcag
ttcaaggaggcggtgcaagcatga

DBGET integrated database retrieval system