KEGG   Geobacillus sp. Y412MC52: GYMC52_0960Help
Entry
GYMC52_0960       CDS       T01399                                 

Definition
(GenBank) catalytic domain-containing protein of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
gya00010  Glycolysis / Gluconeogenesis
gya00020  Citrate cycle (TCA cycle)
gya00620  Pyruvate metabolism
gya01100  Metabolic pathways
gya01110  Biosynthesis of secondary metabolites
gya01120  Microbial metabolism in diverse environments
gya01130  Biosynthesis of antibiotics
gya01200  Carbon metabolism
Module
gya_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:gya00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GYMC52_0960
   00020 Citrate cycle (TCA cycle)
    GYMC52_0960
   00620 Pyruvate metabolism
    GYMC52_0960
Enzymes [BR:gya01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     GYMC52_0960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N ATP-synt_ab_Xtn
Motif
Other DBs
NCBI-ProteinID: ADU93431
UniProt: A0A0E0T9Z0
Position
998306..999610
Genome map
AA seq 434 aa AA seqDB search
MAFEFKLPDIGEGIHEGEIVKWFVKPGDEVNEDDVLCEVQNDKAVVEIPSPVKGKVLEIL
VPEGTVATVGQTLITLDAPGYENMTFKGQEHEEVKKEEKAETVSKKEMVETAAPSAPAAE
AEADPNRRVIAMPSVRKYAREKGVDIRLVQGTGKNGRILKEDIDAFLAGGAKAAAEPTPQ
AAEEKAAPQAPAAKPVVPEGEFPETREKMSGIRRAIAKAMVHSKHTAPHVTLMDEADVTK
LVAHRKKFKAIAAEKGIKLTFLPYVVKALVSALREYPVLNTSIDDATEEIIHKHYYNIGI
AADTDRGLLVPVIKHADRKPIFALAKEINELAEKAREGKLMPNEMKGASCTITNIGSAGG
QWFTPVINHPEVAILGIGRIAEKPIVRDGEIVAAPVLALSLSFDHRMIDGATAQKALNHI
KQLLSDPELLLMEA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
gtggcatttgaatttaagctgccggacattggcgaaggcattcacgaaggcgagatcgtc
aaatggttcgtcaagccgggcgatgaagtgaacgaagacgacgtgttgtgcgaagtgcaa
aacgacaaagcggtcgtcgagatcccatctcctgtcaaggggaaagtgcttgagattctc
gtcccggaaggaacggtggcgacggttgggcaaacgctcattacgctcgatgcgccgggc
tatgaaaacatgacgtttaaaggacaagaacacgaagaagtgaaaaaagaggaaaaagcg
gaaacggtgtcgaaaaaggaaatggttgagaccgctgctccgagcgcaccggcggccgaa
gcggaagccgacccgaaccgccgcgtcatcgcgatgccgtctgtgcgcaaatatgcgcgt
gaaaaaggcgtcgatatccgcctcgtccaaggcacggggaaaaacggccgcattttgaaa
gaagatattgatgccttcctcgccggcggcgcgaaagccgcggctgagccgacgccgcaa
gcggcggaagagaaggcagcgccgcaagcgccagcggcgaaaccggttgtgccggaaggc
gaattcccggaaacgcgcgagaaaatgagcggcatccgtcgggcgatcgccaaggccatg
gtgcattcgaaacatacggccccgcacgtgacgctgatggacgaagccgatgtgacgaag
cttgttgctcaccgaaaaaaattcaaggccattgccgcggaaaaaggcatcaagctgacg
ttcttgccgtatgtcgtcaaagcgcttgtttccgcgctgcgtgaatatccggtgctgaat
acgtcgatcgacgatgcgacggaggaaattattcataagcattactacaacatcggcatc
gccgctgatacggatcgagggttgctcgtgccggtcattaaacatgccgaccggaagccg
attttcgcgctggcgaaggaaatcaacgaactcgctgaaaaagcgcgcgaaggcaaactg
atgccaaacgaaatgaaaggcgcatcgtgcacgatcacgaacatcggctcagccggcggg
caatggtttacgccggtcatcaaccatccggaagtggcgattcttggcatcggccgcatt
gcggaaaaaccgatcgtccgcgacggtgaaattgtcgctgctccggtcttggcgctctcg
ttgagctttgaccatcggatgatcgacggagcgacagcgcaaaaagcgctcaaccatatc
aagcagctgttaagcgatccagaattattattaatggaggcgtaa

DBGET integrated database retrieval system