KEGG   Geobacillus sp. Y412MC52: GYMC52_1018Help
Entry
GYMC52_1018       CDS       T01399                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanine/D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
gya00471  D-Glutamine and D-glutamate metabolism
gya00550  Peptidoglycan biosynthesis
gya01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gya00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    GYMC52_1018
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    GYMC52_1018
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gya01011]
    GYMC52_1018
Enzymes [BR:gya01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     GYMC52_1018
Peptidoglycan biosynthesis and degradation proteins [BR:gya01011]
 Precursor biosynthesis
  Amino acid ligase
   GYMC52_1018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C 2-Hacid_dh_C AlaDh_PNT_C Pyr_redox_3 NAD_binding_7 Cytochrom_C552
Motif
Other DBs
NCBI-ProteinID: ADU93489
UniProt: A0A0E0T9U2
Position
1051515..1052870
Genome map
AA seq 451 aa AA seqDB search
MKPTRFYQHRRVLVIGLAKSGAAAARLLAELGAKVVVNDQKPLSENMEAKQLEPLGIRVV
CGGHPLELLDEPFDLVVKNPGIPYTNPMVKKALEKGLPVVTEVELAYHISEGPFIGITGS
NGKTTTTTLIYEMLKADGQDPLLAGNIGLVACEVAREAKPGQWLVTELSSFQLAGIDKFR
PAIAVLLNIFDAHLDYHGTKEAYAAAKANIFRNQTERDYAVVNADDPLVMNIASSVRSQK
VLFSATKLLGEGAYVQDGAIYWNGDPVIRIADIVLPGQHNLENILAAMAAAKLAGASDEA
IRQVLATFSGVKHRLQYVAEIDGRRFYNDSKATNILATQKALSAFAGEPVILLAGGLDRG
NEFDDLLPYLQQVKAVVLFGQTADKIGRIAQKAGIETIRYVDNVEKAVPVAFELSEPGDV
ILLSPACASWDQYKTFEERGDIFINAVHKLK
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaccgactcgtttttatcaacatcgtcgtgtgcttgtcattggattggcgaaaagc
ggagcggcggcagctcggcttcttgcggagttaggcgctaaggtcgtcgtcaatgatcaa
aagccgctttcggaaaacatggaggctaagcagcttgaaccgctcggcattcgcgtcgtt
tgcggcggtcatccgcttgaactgcttgatgagccgtttgaccttgtcgtgaaaaacccg
ggcattccgtacacgaacccgatggtgaaaaaggcgcttgagaaggggcttccggttgtg
accgaagtggagcttgcttatcacatttccgaagggccgtttatcggcatcaccgggtcc
aacggaaaaacgacgacgacgacgctcatttacgaaatgttaaaagcggatggccaagat
ccgctgcttgccggcaacatcggccttgtcgcctgcgaggtggcgagggaagcgaagccg
gggcaatggcttgtcacggaactgtcttcgttccagcttgccggcattgacaagtttcgc
ccagccattgcggttttgctcaatattttcgacgcccacttggactaccacggaacgaaa
gaggcgtatgcagcggcaaaggcgaacattttccgcaatcaaacggagcgcgattatgcc
gtcgtcaatgccgacgatccgctcgtgatgaacattgcctcctcggttcgatcgcaaaaa
gtgctgttttcggcgacgaagcttcttggcgaaggggcgtacgttcaagatggcgccatc
tattggaacggtgatccagttatcagaatcgctgacatcgttcttcctggacagcacaat
ttggaaaacattttagcggcgatggcggccgccaagctggccggcgccagtgatgaggcg
atccgccaggtgctggcgacgttttccggcgtgaaacatcggcttcagtatgtggcggaa
attgacggccggcggttttacaacgactcgaaagcgacgaacatcttagcgacgcaaaag
gcgctttcagcgtttgccggcgagccggtcattttgttggccggcgggcttgaccgcggc
aatgagtttgatgatcttctcccgtatttgcaacaggtgaaggcggtcgtactgttcggc
cagacggcggataaaatcggccgcatcgcccaaaaagcgggaatagaaacgatccgatat
gtcgataatgtggaaaaagccgtcccggttgctttcgagctttccgagccgggcgacgtc
attttgctctctccagcatgcgccagctgggatcaatacaaaactttcgaggagagaggg
gacatttttatcaatgccgtgcataagttgaaatag

DBGET integrated database retrieval system