KEGG   Geobacillus sp. Y412MC52: GYMC52_1498Help
Entry
GYMC52_1498       CDS       T01399                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
gya00620  Pyruvate metabolism
gya00630  Glyoxylate and dicarboxylate metabolism
gya01100  Metabolic pathways
gya01110  Biosynthesis of secondary metabolites
gya01120  Microbial metabolism in diverse environments
gya01200  Carbon metabolism
Module
gya_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:gya00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    GYMC52_1498
   00630 Glyoxylate and dicarboxylate metabolism
    GYMC52_1498
Enzymes [BR:gya01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     GYMC52_1498
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: ADU93948
UniProt: A0A0E0TB66
Position
1550789..1552972
Genome map
AA seq 727 aa AA seqDB search
MGEYVQKGNIQVAKVLYDFVNEELLPNSGLDQDKFWSDFGALISDLTPRNKELLARRDEI
QEKLNEWHKAHRGRFDFNEYKAFLTDIGYLEPEVEDFAITTDNVDDEIAVQAGPQLVVPL
TNARYALNAANARWGSLYDALYGTDAISEEDGAERGSSYNPVRGAKVIVYGRQFLDEAVP
LAEHSHQDVVQYAVVDGRLVVTTEGGATTGLKEPEKFVGFQGDPQHPTAVLLKNNGLHIE
IQIDREHAVGKTDKAGIKDIVLEAAVTTIMDGEDSVAAVDAEDKVLVYRNLFGLVKGDLT
ATFEKNGKIMTRSLNPDRVYKTPDGGELVLPGRSLMFVRNVGHLMTNNAILHANGEEVHE
GIMDAVITSLIMKHSLIGNTRYLNSRKGSIYIVKPKMHGSAEVAFANELFDRVEDMLGLE
RNTIKIGVMDEERRTSLNLKNCIYQVRDRIIFINTGFLDRTGDEIHTSMEAGPMLRKNEM
KSSTWLQAYEKSNVAVGLAAGFRGRAQIGKGMWAMPDLMAEMLKQKGAQLKAGANTAWVP
SPTAATLHALHYHQVNVSAVQSELANDRNDYRDDMLQIPVVDHPQWTAEEIQEELDNNCQ
SILGYVVRWIDQGIGCSKVPDIHNVGLMEDRATLRISSQILANWLHHGICTKEQVLETLK
RMAKVVDEQNAGDPNYRPMAPNYDDSVAFQAACDLIFRGYEQPNGYTEPILHRRRQEAKA
KFAAIQQ
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaatacgtacaaaaagggaacatccaagtcgccaaagtgttgtacgactttgtc
aacgaggagcttctgccgaacagcgggttggatcaagacaagttttggagcgatttcggc
gcgctcatttccgacttgacgccgcgcaacaaagaattgctcgcccgccgcgacgaaatt
caagaaaaattgaatgagtggcataaagcgcatcgcggccgctttgattttaacgaatat
aaagcatttttgacagacatcggctatttggagccggaagtcgaggactttgcgattacg
accgacaatgtcgacgatgaaattgccgtgcaagccgggccgcagctcgtcgtgccgctc
acgaacgcccgctatgcattaaacgctgccaacgcccgttggggcagcctgtacgacgcg
ctgtacggcaccgatgccatcagcgaggaagacggcgccgagcgcggttcgtcgtacaac
ccggtgcgcggggcgaaagtcatcgtctacgggcggcagtttttggatgaagcagtgccg
cttgccgaacattcccatcaagacgtagtccaatacgcggtcgttgacgggcggctcgtc
gtgacgacagaaggcggggcgacgacggggctgaaagagccagaaaaatttgtcggtttc
caaggcgacccgcaacatccgacagcggtgttgctgaagaacaatggccttcacattgaa
attcaaatcgaccgcgagcatgcggtcggaaaaacggataaagccggcatcaaagacatc
gtgttggaggcggcggtcacgacgatcatggacggcgaagattcggtggcggccgttgac
gccgaagacaaagtgctcgtttaccgcaacttgtttggtctcgttaaaggcgatttgaca
gcgacatttgagaaaaacggcaaaatcatgacgcgctccctgaacccggatcgcgtatac
aaaacgccggatggcggggagctcgtgctgccgggccgttcgctcatgttcgtgcgcaac
gtcgggcacttaatgacgaacaacgcgatcttgcatgcgaatggcgaggaagtgcatgaa
gggatcatggacgccgtcattacaagcttgattatgaaacattcgctcatcggcaataca
cgctacttgaattcgcgcaaaggttccatctacatcgtcaagccgaaaatgcacggatcg
gcggaagtggcgtttgccaacgagctgtttgaccgcgtcgaagacatgctcggccttgag
cggaatacgattaaaatcggcgtgatggacgaggagcgccgcacgtcgctcaacttgaaa
aactgcatctaccaagtgcgcgaccgcatcatttttatcaacaccggcttcctcgaccgg
accggagacgaaattcatacgtcgatggaagcggggccgatgctgcgcaaaaacgagatg
aaatcatcgacttggctgcaggcgtatgaaaaatcgaacgtcgccgttgggcttgccgcc
ggcttccgcggccgggcgcaaatcggcaaaggaatgtgggcgatgccggatttgatggca
gaaatgctgaagcaaaaaggagcgcagctcaaagcaggcgccaatacggcatgggtgccg
tcgccgacagcggccacgctccatgcgcttcattaccatcaagtgaacgtctccgctgtg
caaagcgaactggcgaacgatcggaacgattatcgcgacgacatgttgcaaatcccggtc
gttgaccacccgcaatggacagcggaagagattcaagaagagctcgacaacaactgccaa
agcattttaggctatgtcgtccgctggatcgaccaagggatcggctgctcgaaagtgccg
gacattcacaacgtcggactgatggaagaccgggcgacgcttcgcatctcgagccaaatt
ctcgccaactggctccatcatggcatttgcacgaaagagcaagtgcttgagacgctcaag
cggatggcaaaagtcgtcgacgaacaaaacgccggcgatccgaactatcgtccgatggcg
ccgaattacgatgattcggtggcgttccaagcggcatgcgatctcattttccgcggctat
gaacagccaaacggctataccgagccgattttgcaccgccgccgtcaagaagcaaaagcg
aaatttgccgccattcagcaataa

DBGET integrated database retrieval system