KEGG   Geobacillus sp. Y412MC52: GYMC52_1853Help
Entry
GYMC52_1853       CDS       T01399                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
gya00010  Glycolysis / Gluconeogenesis
gya00052  Galactose metabolism
gya01100  Metabolic pathways
gya01110  Biosynthesis of secondary metabolites
gya01120  Microbial metabolism in diverse environments
gya01130  Biosynthesis of antibiotics
Module
gya_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:gya00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GYMC52_1853
   00052 Galactose metabolism
    GYMC52_1853
Enzymes [BR:gya01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     GYMC52_1853
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ADU94275
UniProt: A0A0E0TC66
Position
complement(1911309..1912361)
Genome map
AA seq 350 aa AA seqDB search
MNITYEKWSELNGNDILLFILTNDRGIKLSATNYGCIVTDIRVPDRNGNIENVALGFGRF
EPYLTNAPYFGAVIGRVAGRIRGASFELDGITYQLAKNENNNHLHGGPNGFHHVLWQAEP
VQRNNAVGVVFSYTSPDGEEGYSGTVHVQVEYWLNSDNEWIVTYRARSDKTTLVNLTNHT
YFNLSGNGKRDILDHMLTIQSSRVLELNEELIPTGRVLDVAGTPFDLRQGKTIREAVESG
HPQIELVGGGYDHPFWLDRHHDKEIVLSDPESGRILTVETDEVGVVVYTSNQLPEGLDLG
GVPSRKYLGICLETQGLPDAVHHPQFPSIVLPAGKERVSTTVYRFGVRSS
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaacattacatacgaaaaatggtccgaactgaatggaaacgatattctcttgttcatc
ttgacaaacgaccgtggcataaaactgtcggcgacaaactacggatgcatcgtgacggac
atccgcgttcccgaccggaacggcaatatcgaaaatgtcgcgctcgggtttggccggttt
gaaccgtatttaaccaacgccccttactttggtgcggtgatcggccgcgtggccggacgc
attcgcggggcgagcttcgaactagatggaatcacgtatcaattggcgaaaaacgaaaac
aacaaccacttgcacggcggcccgaacggattccatcacgtgctttggcaggcggaaccg
gttcagcgcaataatgcagtgggggtcgtgttttcatacacaagcccggacggggaagag
ggatattcgggaacggttcatgttcaagtggaatattggctgaatagtgacaacgaatgg
atcgtcacgtaccgggctcgttcagacaaaacgacgctcgtcaatttgacgaaccatacg
tattttaacttgagcggcaacggcaagcgtgatattttggatcacatgctgaccatccaa
agctcccgtgtgctggagctgaatgaggaactgattccgactggccgcgtcttggatgtc
gctggcacgccgtttgatttgcggcaaggaaagacgatacgggaggcggtcgaatccggg
catccgcaaattgaactcgtcggcgggggctatgaccatccgttttggctcgatcggcat
catgacaaagagattgtgctttccgatccggagagtgggcggatattgacagtcgagacg
gatgaagtcggcgtcgtcgtgtatacgtcgaatcagttgccggaagggttggatttgggc
ggcgtgccgtcgcggaaatatctcggcatttgcttagaaacacaagggttgccggatgca
gttcatcatccgcagtttccgtcgattgtattgccagctggcaaagagcgagtgtcaacg
acagtctatcggtttggcgtgcgatcgtcgtaa

DBGET integrated database retrieval system