KEGG   Geobacillus sp. Y412MC52: GYMC52_2184Help
Entry
GYMC52_2184       CDS       T01399                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
gya00400  Phenylalanine, tyrosine and tryptophan biosynthesis
gya01100  Metabolic pathways
gya01110  Biosynthesis of secondary metabolites
gya01130  Biosynthesis of antibiotics
gya01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gya00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GYMC52_2184
Enzymes [BR:gya01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     GYMC52_2184
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS His_biosynth NMO FMN_dh
Motif
Other DBs
NCBI-ProteinID: ADU94586
UniProt: A0A0E0TD81
Position
complement(2257533..2258312)
Genome map
AA seq 259 aa AA seqDB search
MMLEQILAAKREEVETLTLPAPLPERKRRPFAAALRRPRRMLGLIAEVKKASPSKGIIRP
NFDPVAIAKAYERAGADAISVLTDERYFQGHRRYLRAVKEAVNVPVLRKDFIIDRRQVEE
SVRLGADAILLIGEALPPETLEGLYHEAYSLGLECLVEVHAKETLERIFDRFTPEIVGIN
NRDLHTFVTTLEATKTLAPLIPPSCVIVSESGIGSFNDVKTVKSYGAQAMLVGESLMRQD
DVERAVYRLFGEEDGDDSN
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgatgcttgagcaaattttagcagccaaacgggaagaagtggaaacgttgacgctgccg
gcgccattgccagagcgaaagcgccggccatttgcggcggcgctccgtcggccgcggcgg
atgcttggcttgatcgctgaggtgaaaaaagcgtcgccgtcaaaaggcatcattcgcccg
aattttgacccggtggccatcgcgaaagcatatgagcgcgccggtgccgacgcgatcagc
gtgctgacggatgaacggtattttcaagggcatcgccgctatttgcgagcggtgaaagaa
gcggttaacgttcccgtgctgcgcaaagatttcatcatcgatcggcggcaagtcgaggaa
agcgtccgactcggggcggatgcgattttattgatcggcgaggcgctcccgccggaaaca
ctcgaggggctctatcatgaagcgtacagcttggggctcgaatgtctggtcgaggtgcat
gcaaaagagacgctcgagcggattttcgatcggtttacgccggagatcgtcggcatcaac
aaccgcgacttgcatacctttgtgacaacacttgaggcgaccaaaacgctcgctccgctc
atcccgccatcgtgcgtcatcgtcagcgaaagcgggatcggttccttcaatgatgtgaag
acggtcaaatcgtacggagcgcaggccatgctcgtcggcgagtcgctcatgcgccaagat
gatgtggagcgagcggtctaccggctgtttggggaggaagatggggatgattcgaattaa

DBGET integrated database retrieval system