KEGG   Geobacillus sp. Y412MC52: GYMC52_2196Help
Entry
GYMC52_2196       CDS       T01399                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
gya00790  Folate biosynthesis
gya01100  Metabolic pathways
Module
gya_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:gya00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    GYMC52_2196
Enzymes [BR:gya01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     GYMC52_2196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF BCDHK_Adom3 EccE Adeno_GP19K
Motif
Other DBs
NCBI-ProteinID: ADU94598
UniProt: A0A0E0TD05
Position
complement(2268033..2268599)
Genome map
AA seq 188 aa AA seqDB search
MPEINFAQIEYAVRLILEAIGEDPNREGLVDTPKRVAKMYAEVFAGLQEDPKQHFQTVFS
EEHEELVLVKDIPFYSMCEHHLVPFFGAAHVAYIPREGKVTGLSKLARAVEAVARRPQLQ
ERITATIADSIVEALEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGVFETDANARA
EVLSLIKA
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgccagagatcaattttgcgcaaattgaatatgcggtccgcctcattcttgaggcgatc
ggggaagatccaaaccgcgaagggctcgtcgatacgccgaagagggtggcgaaaatgtac
gccgaggtgttcgctgggctgcaggaagacccgaagcagcactttcaaaccgtattcagc
gaggaacatgaggagcttgtgctcgtcaaagatattccgttttattcgatgtgcgaacac
catttagtgccgttttttggcgctgcccacgtcgcctatattccgcgggaagggaaagtg
accgggctgagcaagctcgctcgagccgttgaggcggtggcgcgccgcccgcagctgcaa
gagcgcatcacggcaacgatcgctgattcgatcgtcgaggcgcttgagccgcatggggtg
atggtcgtcgttgaggcggagcatatgtgcatgacgatgcgcggggtgaaaaaaccgggg
gccaaaacagtgacaacagcggtgcgcggcgtgtttgaaacagatgccaacgcccgcgct
gaagtgctttcgttaatcaaagcgtaa

DBGET integrated database retrieval system