KEGG   Geobacillus sp. Y412MC52: GYMC52_2415Help
Entry
GYMC52_2415       CDS       T01399                                 

Definition
(GenBank) Polyprenyl synthetase
  KO
K13789  geranylgeranyl diphosphate synthase, type II [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
gya00900  Terpenoid backbone biosynthesis
gya01100  Metabolic pathways
gya01110  Biosynthesis of secondary metabolites
gya01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:gya00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GYMC52_2415
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:gya01006]
    GYMC52_2415
Enzymes [BR:gya01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     GYMC52_2415
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     GYMC52_2415
    2.5.1.29  geranylgeranyl diphosphate synthase
     GYMC52_2415
Prenyltransferases [BR:gya01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   GYMC52_2415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: ADU94798
UniProt: A0A0E0TDJ9
Position
complement(2486700..2487593)
Genome map
AA seq 297 aa AA seqDB search
MAQLSVEQFLNEQKRAVEAALSSYMARLRGPETLKKAMAYSLEAGGKRIRPLLLLATIQA
LGKDPAIGLPVACAIEMIHTYSLIHDDLPSMDNDDLRRGKPTNHKVFGEAMAILAGDALL
TYAFQLMAEIDDDRVPPPVRLQLIEQLAKAAGPEGMVAGQAADMEAEGKTLALAELEYIH
RHKTGKMLQYSVHAGALLGGADGRQTRELNEFAAHLGLAFQIRDDILDIEGMEEKIGKRV
GSDRDNKKATYPVLLSLGGAKEKLAFHIDAAKRHLQQAKIDDAVLAYICELVAVRDH
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcagctttcggttgaacagtttctcaacgaacaaaaacgggccgtcgaggcggcg
ctttcctcctatatggcgcggcttcgtgggccggagacgctgaaaaaggcgatggcctac
tcgcttgaggccggcggcaaacgaatccgcccgcttttgttgctggcgaccatccaagcg
cttggcaaagacccggcgatcggtctgccagtcgcttgcgccattgaaatgatccatacg
tactcgctcattcatgatgatttgccaagcatggacaacgatgatttgcggcgcggcaaa
ccgacgaaccataaagtgttcggcgaggcgatggccattttggccggggacgctttgttg
acgtatgcctttcaattgatggccgaaatcgatgatgatcgcgtgccgcctcccgtccgt
ctgcagctcatcgagcagctcgcgaaggcggccggcccggaaggcatggtcgctggacag
gcggctgatatggaggcggaaggaaaaacgctggcgcttgcggaactggaatacatccac
cgccataagacggggaaaatgctgcaatacagcgtgcacgccggcgccctgcttggcggc
gccgatggtcggcagacgcgcgaactcaacgagttcgccgcacatttaggcctcgccttt
caaattcgcgacgatattttggacattgaaggaatggaagaaaaaatcggcaagcgagtc
ggcagcgaccgcgacaacaagaaggcgacatatccggtgcttctttcgctaggcggtgct
aaagagaaactggcgtttcacattgacgccgcgaagcgccatttgcagcaagccaaaatc
gatgacgcggtgctggcctacatttgcgagcttgtcgcggtccgcgaccactga

DBGET integrated database retrieval system