KEGG   Geobacillus sp. Y412MC52: GYMC52_2562Help
Entry
GYMC52_2562       CDS       T01399                                 

Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
gya00564  Glycerophospholipid metabolism
gya01100  Metabolic pathways
gya01110  Biosynthesis of secondary metabolites
Module
gya_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:gya00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    GYMC52_2562
Enzymes [BR:gya01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     GYMC52_2562
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase DsrD HU-CCDC81_bac_2
Motif
Other DBs
NCBI-ProteinID: ADU94943
UniProt: A0A0E0TE05
Position
complement(2613394..2614188)
Genome map
AA seq 264 aa AA seqDB search
MRKWLYRLFIELTNHSLSSKLLASFAKSRLSGLLISSYAKIYHINQDEMEKSLKNYKTLQ
QLFVRRLKAGVRPVDADEHTVVSPVDAVIEDMGTIRENCEMIVKGKPYSIAEMLGSVEAA
QPYVNGFFFILYLSPSHYHRIHSPISGVIEKQWALGRKSYPVNRLGLKYGRRPLEKNYRL
ITEVTAGGKRLAIVKIGAMFVNSIELTHEGEQLVKGEEMAYFSFGSTVVLLFERGSFAPD
PRIVAPMPIKVGERLGYWCEAHER
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
ttgcgaaaatggctttatcgtttgttcatcgagctgaccaatcactcgctttcttcaaag
ctgctcgcttcgtttgccaaatcgcgcctcagcgggctattgatatcatcgtatgcaaaa
atttatcatattaaccaagacgaaatggaaaaaagcctaaaaaattataagacgttgcag
caactgttcgttcgccggctgaaggccggggtgaggccggtcgacgctgatgagcatacg
gtcgtcagcccggtcgacgctgtcattgaagacatgggcacgattcgagaaaactgtgaa
atgatcgtcaagggaaagccgtattccattgcggaaatgctcggcagcgttgaagcggca
caaccgtatgtgaacgggttcttttttattctgtatttaagcccgagccattatcaccgc
atccacagcccaatatctggagtgatcgaaaagcagtgggcgctcggccgcaagtcgtat
ccagtcaaccgtcttggcttaaaatatgggcgtcggccgctcgagaaaaattaccgcctc
atcaccgaggtcacagccggcggcaagcgcttggcgatcgtgaaaatcggcgccatgttc
gtcaacagcattgaattgacccatgagggtgagcagcttgtaaaaggagaggaaatggcg
tatttttcgttcggttcaacggtcgtcttgctgtttgaacgcggaagtttcgcccctgac
ccgcgcattgttgcgcccatgccgatcaaagtcggcgagcggctcggctattggtgcgag
gcgcacgagcgctaa

DBGET integrated database retrieval system