KEGG   Geobacillus sp. Y412MC52: GYMC52_2896Help
Entry
GYMC52_2896       CDS       T01399                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
gya00010  Glycolysis / Gluconeogenesis
gya00020  Citrate cycle (TCA cycle)
gya00620  Pyruvate metabolism
gya01100  Metabolic pathways
gya01110  Biosynthesis of secondary metabolites
gya01120  Microbial metabolism in diverse environments
gya01130  Biosynthesis of antibiotics
gya01200  Carbon metabolism
Module
gya_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:gya00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GYMC52_2896
   00020 Citrate cycle (TCA cycle)
    GYMC52_2896
   00620 Pyruvate metabolism
    GYMC52_2896
Enzymes [BR:gya01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     GYMC52_2896
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_16 AAA_33
Motif
Other DBs
NCBI-ProteinID: ADU95264
UniProt: A0A0E0TER7
Position
2956910..2958496
Genome map
AA seq 528 aa AA seqDB search
MGIANMTNKLDLLLQKPYVHHQLSVAELVEKVLQRNEGRLTHTGAVAVTTGKYTGRSPKD
KYIVEEPSTKQTIDWGAVNQPMSPETFDKLYDKVLDYLMKKDELFVFKGFAGADPKYRLP
IQVVNEFAWHNLFVHQLFIRPSAEELAAHEPQFTVICAPNFKADPKVDGTRSEAFIIISF
ERRTVLIGGTEYAGEMKKSIFSVMNYLLPEQGILPMHCSANVGQEGDVALFFGLSGTGKT
TLSTDPNRRLIGDDEHGWSSRGIFNIEGGCYAKCINLSREKEPQIFDAIGFGAVLENVVL
DDATRVPNYDDGTLTENTRAAYPLQAIQNIIDPSVAGHPSTIVFLTADAFGVLPPISKLT
REQAMYHFLSGYTSKLAGTERGVTEPEATFSTCFGAPFLPRPAIEYAEMLGQKIAEHNVR
VFLVNTGWTGGPYGVGSRMKLAYTRAMVQAAVEGELDNAETVQDPIFGLAIPTHVPGVPD
EVLQPQNTWADKQAYEQKAKELAQKFRANFQKFAHIDPSIEKLGGPLV
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atggggatcgcaaacatgacgaacaagcttgatttattgctgcaaaaaccgtacgtgcat
catcaactgtccgtcgccgagctcgttgagaaagtcctgcagcggaacgaaggacggctg
acgcacaccggagccgtcgcggtgacaaccggcaagtacacagggcggtcgccgaaagac
aaatacatcgtcgaagaaccgtcaacgaagcaaacgatcgactggggagcggtcaaccag
ccgatgtctccggagacgtttgataaactgtacgacaaagtgctcgactatttaatgaag
aaagatgaactgttcgtgtttaaaggctttgccggcgccgatccgaaataccggctgccg
attcaagtcgtcaacgaattcgcctggcacaacttgttcgtccatcagctgttcatccgg
ccgagcgccgaggagctcgccgcgcatgagccgcaattcaccgtcatttgcgcgccgaac
tttaaagccgacccgaaagttgacggcacgcgctcggaagcgttcatcatcatctcgttt
gaacggcgcaccgtgttgatcggcggcaccgagtatgccggcgaaatgaaaaaatcgatt
ttctcggtgatgaactatttgctgccggaacaaggcatcctgccgatgcactgctcggcc
aacgtcggccaggaaggcgacgtcgccctctttttcggcttgtcgggaacgggaaaaacg
acgctctcgaccgacccgaaccgccgcttgatcggggatgatgaacacggctggtcaagc
cgcggcattttcaacatcgaaggcggctgctatgcgaaatgcatcaacctatcgcgcgag
aaagagccgcaaatttttgacgccatcggcttcggcgcggtgctcgaaaacgtcgttctc
gatgacgcgacgcgggtgccgaattacgacgacggcacgctgacggaaaacacgcgcgcc
gcctacccgcttcaggcgatccaaaacatcatcgatccgagcgtcgccggccatccgtcc
acgatcgtgtttttgacggctgatgcgttcggcgtcctgccgccgatcagcaagctgacg
cgcgaacaagcgatgtaccatttcttaagcggctacacaagcaaactcgccggcaccgaa
cgcggcgtcaccgaaccggaagcaacgttctcaacgtgctttggcgcaccgtttttgccg
cgcccggccattgagtacgcggaaatgctcgggcaaaaaatcgccgaacacaacgttcgc
gtctttttggtcaacaccggctggacagggggaccgtacggcgtcggcagccgcatgaag
ctcgcctacacccgggcgatggtgcaagccgccgtcgaaggggagctggacaacgccgaa
acggtgcaagacccgattttcggcctcgccatcccaacccacgtccccggcgtgccggat
gaagtcctgcagccgcaaaacacatgggccgacaaacaagcatacgaacaaaaagcaaaa
gagctggcgcaaaaattccgcgccaacttccaaaaattcgcccacatcgatccgtccatt
gaaaaactcggcggaccgctcgtgtaa

DBGET integrated database retrieval system