KEGG   Geobacillus sp. Y412MC52: GYMC52_3184Help
Entry
GYMC52_3184       CDS       T01399                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
gya00340  Histidine metabolism
gya01100  Metabolic pathways
gya01110  Biosynthesis of secondary metabolites
gya01230  Biosynthesis of amino acids
Module
gya_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:gya00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    GYMC52_3184
Enzymes [BR:gya01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     GYMC52_3184
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ADU95540
UniProt: A0A0E0TFS9
Position
complement(3210206..3211480)
Genome map
AA seq 424 aa AA seqDB search
MKIERIRGGVSLRRTIESGTEEQRRVVLDIISNVRARGDEALKEYTERFDGVKLDSLKVT
EEEMKRAHAAMDAEMLEIIRQAAANIRDYHERQKRESWWMTKEDGTILGQKVTPLDAVGL
YVPGGTAAYPSSVLMNVIPAQVAGVKRIVITSPPNKDGTLPAGVLAAAYELGVTEIYKVG
GAQAIAALAYGTETIRPVDKIFGPGNIYVALAKREVFGHVAIDMIAGPSEIVVLADETAR
PDEIAADLLSQAEHDVRASAILVTPSMKLALAVASEVERQLETLPRRDIAQAALENYGAI
YVTETLEEAVDVVNELAPEHLEVMTAEPLALFGRLRHAGAMFFGRFSSEPVGDYFAGPNH
VLPTNGTARFSSGLGVDEFVKKSSVIVYSEAALKQHGEKIAAFARLEGLEAHARAIEVRL
EKGE
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcgaacggatccgaggcggcgtttcgctgcggcgcacgattgaaagcggaacg
gaggagcagcggcgcgtggtgctggatatcatttccaacgtgcgcgcccgcggcgatgaa
gcgctgaaagaatacacggaacggtttgacggcgtcaagctggattcgctcaaggtgacg
gaagaggaaatgaagcgcgcgcatgcggcgatggacgcggagatgctggagatcattcgc
caagcggcggcgaacattcgcgactaccatgagcggcaaaagcgcgaatcatggtggatg
acgaaagaagacggcacaattctcggacaaaaggtgacgccgctcgatgcggtcgggttg
tacgtgccaggcgggacggccgcttatccgtcgtctgtgctgatgaacgttattcccgca
caagtggcgggggtgaaacggattgtcatcacctcgccgccaaacaaagacggcacgctc
ccggctggggtgctggccgccgcctatgaactcggcgtgacggaaatttacaaagtcggc
ggcgcgcaggcgatcgccgcgcttgcttacgggacggaaacgattcggccggttgacaaa
attttcgggccgggcaatatttatgtggcattggcgaagcgggaagtgttcgggcatgtg
gcgatcgacatgatcgcggggccgagcgaaattgtcgtgctggcggatgaaacggcccga
ccggatgagattgcggcggatttgttgtcgcaagccgagcatgacgtgcgggcgtcggcc
attttggtgacgccgtcgatgaaattggcgctggcggtggcgagcgaagtcgaacggcag
cttgaaacgctgccgcgccgcgacattgcccaagcggcgcttgagaactacggcgccatt
tacgtcaccgagacgcttgaggaagcggtggatgttgtgaacgaactggcgccggagcat
ttggaagtgatgacggcagaaccgctcgcgcttttcggccggctccgccatgcgggagcg
atgtttttcggccgcttcagctccgagccggtcggcgactatttcgccgggccgaaccac
gtgctgccgacgaacggtacggcaaggttttcaagcggtctcggcgtcgatgagtttgtg
aaaaaatcaagcgtgattgtttacagtgaagccgcattgaaacaacatggagaaaaaatc
gccgcctttgcccgcctcgaggggctggaggcgcacgcgcgcgccattgaggtgcggctc
gagaaaggggaatga

DBGET integrated database retrieval system