KEGG   Geobacillus sp. Y412MC52: GYMC52_3485Help
Entry
GYMC52_3485       CDS       T01399                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
gya00071  Fatty acid degradation
gya00072  Synthesis and degradation of ketone bodies
gya00280  Valine, leucine and isoleucine degradation
gya00310  Lysine degradation
gya00362  Benzoate degradation
gya00380  Tryptophan metabolism
gya00620  Pyruvate metabolism
gya00630  Glyoxylate and dicarboxylate metabolism
gya00640  Propanoate metabolism
gya00650  Butanoate metabolism
gya00900  Terpenoid backbone biosynthesis
gya01100  Metabolic pathways
gya01110  Biosynthesis of secondary metabolites
gya01120  Microbial metabolism in diverse environments
gya01130  Biosynthesis of antibiotics
gya01200  Carbon metabolism
gya01212  Fatty acid metabolism
gya02020  Two-component system
Brite
KEGG Orthology (KO) [BR:gya00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GYMC52_3485
   00630 Glyoxylate and dicarboxylate metabolism
    GYMC52_3485
   00640 Propanoate metabolism
    GYMC52_3485
   00650 Butanoate metabolism
    GYMC52_3485
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GYMC52_3485
   00072 Synthesis and degradation of ketone bodies
    GYMC52_3485
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GYMC52_3485
   00310 Lysine degradation
    GYMC52_3485
   00380 Tryptophan metabolism
    GYMC52_3485
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GYMC52_3485
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GYMC52_3485
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    GYMC52_3485
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gya04147]
    GYMC52_3485
Enzymes [BR:gya01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     GYMC52_3485
Exosome [BR:gya04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GYMC52_3485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III SpoVAD DUF2496
Motif
Other DBs
NCBI-ProteinID: ADU95829
UniProt: A0A0E0TGD4
Position
complement(3519609..3520787)
Genome map
AA seq 392 aa AA seqDB search
MGKTVIVSGARTPFGKFGGSLQALSASELGGIAVKEALARADVSAEQVDHVILGTVLQGG
QGQLPSRQAMRHAGIPWHVRTETVNKVCASGMRAVTLADQLIRLGDADVVVAGGMESMSN
APYVLPKARWGLRMGDSTVKDLMVYDGLTCSFTGVHMGVYGGNTARELGITREAQDEWAY
RSHMRAIAAIEAGRLAEEIVPVTIPQRKGEPLVVEHDEAPRKDTSLEALAKLPPVFDPEG
TITAGNAPGVNDGAAALVLMSEERAAREGLEPLATVVAHTAIAVEAKDFPKTPGLVINEL
LRKTGKTVDDIALFEINEAFAAVALAAIQIAGLDPEKVNVNGGAVALGHPIGASGARIIL
TLIYELKRRGGGLGIAAICSGGGQGDAILVEV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaacagtgattgtcagcggggcgcgcaccccgtttggaaaattcggcggttct
ttgcaagcgctgtcagcgtcagaactcggcggcattgccgtgaaagaagcgcttgcccgc
gcggacgtgagcgcggaacaagtcgatcatgtcattttaggcaccgtcttgcaaggcgga
caaggacagctcccatcgcggcaggcgatgcgccatgccggcattccgtggcatgttcgc
accgagacggtcaataaagtatgcgcatcgggcatgcgcgccgtgacgctcgcggatcag
ctcatccgcttaggcgacgccgatgtcgttgtcgcgggcgggatggaatcgatgagcaac
gccccgtacgtgctgccgaaagcgcgctgggggttgcgaatgggcgacagcacggtgaag
gatttaatggtgtatgatggcttgacatgcagttttaccggcgtccatatgggcgtttat
ggcgggaatacagcgcgtgaacttggcattacacgcgaggcgcaggatgagtgggcgtac
cgcagccatatgcgagccattgccgccatcgaagccggtcggctcgcggaagagatcgtt
ccggtgacgattccgcagcgcaaaggagagccgcttgtcgtcgaacacgacgaggcgccg
cgcaaagacacgtcgcttgaagcgttggcgaaactgccgccggtgtttgacccggaagga
acgatcactgccggcaacgccccgggcgtcaacgacggcgccgcggcgctcgtcttgatg
agcgaggagcgcgccgcccgcgaggggcttgagccgctcgcgactgttgtcgcccacacc
gccatcgccgttgaggcgaaagatttcccaaaaacgccgggacttgtcatcaacgagctg
ctccgcaaaacgggaaaaacggtcgacgacattgccttgttcgaaataaacgaagcgttt
gccgctgttgctcttgctgctatccaaatcgccggccttgacccggaaaaagtgaacgtc
aacggcggcgctgtcgccctcggccacccgatcggcgcgagcggcgcacgcatcatcctc
acgctcatttatgagctgaaacgccgcggcggcggactcggcatcgccgccatctgcagc
ggcggcggccaaggcgacgccatcttggtcgaggtataa

DBGET integrated database retrieval system