KEGG   Geobacillus sp. Y412MC61: GYMC61_0742Help
Entry
GYMC61_0742       CDS       T01101                                 

Definition
(GenBank) Alcohol dehydrogenase zinc-binding domain protein
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
gyc  Geobacillus sp. Y412MC61
Pathway
gyc00010  Glycolysis / Gluconeogenesis
gyc00071  Fatty acid degradation
gyc00350  Tyrosine metabolism
gyc00625  Chloroalkane and chloroalkene degradation
gyc00626  Naphthalene degradation
gyc00680  Methane metabolism
gyc01100  Metabolic pathways
gyc01110  Biosynthesis of secondary metabolites
gyc01120  Microbial metabolism in diverse environments
gyc01200  Carbon metabolism
gyc01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gyc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GYMC61_0742
  09102 Energy metabolism
   00680 Methane metabolism
    GYMC61_0742
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GYMC61_0742
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    GYMC61_0742
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    GYMC61_0742
   00626 Naphthalene degradation
    GYMC61_0742
Enzymes [BR:gyc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     GYMC61_0742
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     GYMC61_0742
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C ThiF F420_oxidored AlaDh_PNT_C NADH_4Fe-4S 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ACX77413
Position
732468..733574
Genome map
AA seq 368 aa AA seqDB search
MAKAAVLHRYGEPLSIEELDLASPKRGEVKVKMKAAGLCHSDWHVVQGQLPLPLPIVLGH
EGAGIVEEVGEGVTSVKQGDHVVLNWVPSCGTCSYCRTGRPDLCEEAARLTATGTLPDGT
TRFSWQGKPVYQFLTAGAFSEYTIVPEQAAIPIRRDVPFELAALISCSVMTGVGAVIHTA
RLRPGSTVAVIGAGGVGFNIIQGAALAGAKQIIAIDVVDEKLAMTKTFGATHTVNARKDD
AVSAVLDLTDGIGVDYAFEAIGRPETMADAYNMTRKAGTTVIVGIAAPHETVEINAFSLP
SQSKTLTGSWLGQGNPPVDYPKLLDLYAAGKLKLEPLISAVYSLDQINDGFAALKSGQNI
RGIIRFEE
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagccgcagtattgcaccgctacggggagccgctgtcaatcgaagaactggat
ttggcaagccccaagcgcggggaagtcaaagtgaaaatgaaagcggcgggcctttgccat
agcgattggcatgtggttcaagggcaattgccgctcccgcttcccattgtgctcggccac
gaaggcgcgggcattgtcgaggaagtcggggaaggggtgacaagtgtcaaacaaggcgac
catgtggtgctcaattgggtgccgtcatgcgggacgtgcagctattgccgcaccgggcgg
cccgatctatgcgaggaagcggcgcggctgacggcgaccggcacgctgccggatgggacg
acgcgtttttcgtggcaagggaagccggtgtatcagtttttaaccgccggcgcgttcagc
gaatacaccatcgtgccggagcaggcagccatcccgatccgtcgggatgtgccgtttgag
ttggcggcattgatcagctgcagcgtcatgaccggggtgggggcggtcattcatacggcc
cgcctccgcccgggcagcacagtcgctgtgattggcgccggcggcgtcggattcaatatc
attcaaggagccgcgttagcgggggcgaaacaaattattgccattgatgtcgtcgatgaa
aaattagcgatgacgaaaacgttcggggcgacgcacaccgtaaacgcccgcaaggacgat
gccgtcagcgccgtgctcgacttgaccgacggcatcggcgtcgactatgcgtttgaagcg
atcggccgcccggagacgatggccgacgcatacaacatgacgcgaaaagcgggaacgacg
gtcatcgtcggcatcgccgcgccgcatgaaacggtggagatcaacgccttttcgctgccg
tcccaatccaaaacgttgaccggttcttggcttggccaaggcaatccgccggttgactac
ccgaagctgcttgatttgtacgcggcgggcaagctgaagctcgaaccgctcatcagcgcc
gtctattcgctcgaccaaatcaacgacggattcgccgccttaaagagcgggcaaaacatt
cgcggcatcattcgctttgaagaatga

DBGET integrated database retrieval system