KEGG   Geobacillus sp. Y412MC61: GYMC61_0750Help
Entry
GYMC61_0750       CDS       T01101                                 

Definition
(GenBank) molybdenum cofactor synthesis domain protein
  KO
K03638  molybdopterin adenylyltransferase [EC:2.7.7.75]
Organism
gyc  Geobacillus sp. Y412MC61
Pathway
gyc00790  Folate biosynthesis
gyc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gyc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    GYMC61_0750
Enzymes [BR:gyc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.75  molybdopterin adenylyltransferase
     GYMC61_0750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MoCF_biosynth
Motif
Other DBs
NCBI-ProteinID: ACX77421
Position
742136..742657
Genome map
AA seq 173 aa AA seqDB search
MSTSEHKQEAPKTVRCKVITVSDTRTEETDRSGRLMIELLTEAGHEVVGYEIVKDEADAI
REAVFDGCRRADVDAVLTNGGTGIAKRDVTIETVGALLEKELVGFGELFRFLSYTEDIGP
AAMLSRAVAGVAMDTAVFCTPGSTGAVRLAMTKLILPELGHVVREIRKDRAPR
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgagcacaagcgaacataaacaagaagcccccaaaaccgtccgctgcaaagtcatcacc
gtcagcgacacgagaacggaggaaaccgaccgaagcggcaggctgatgatcgagctgctc
acggaagccgggcatgaggtcgtcggctatgagatcgtcaaagacgaagcggacgccatt
cgcgaggcagtgtttgacggctgccgccgcgccgatgtcgatgcggtgctcacgaacggc
ggcaccggcatcgccaagcgcgacgtgacgatcgaaacggtcggtgcgctgcttgagaaa
gaactcgtcggctttggcgagctgttccgcttcttgagctacaccgaagacatcggtccg
gccgccatgctgtcgcgcgccgtcgccggcgtggcgatggacaccgccgtcttttgcact
cccggctccaccggcgctgtgcgcctcgcgatgacgaagctcattttgcctgagcttggg
catgtggtgcgggagattcgaaaggatagggcgccgcgttga

DBGET integrated database retrieval system