KEGG   Geobacillus sp. Y412MC61: GYMC61_0956Help
Entry
GYMC61_0956       CDS       T01101                                 

Definition
(GenBank) helicase, RecD/TraA family
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
gyc  Geobacillus sp. Y412MC61
Pathway
gyc03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:gyc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    GYMC61_0956
Enzymes [BR:gyc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     GYMC61_0956
DNA repair and recombination proteins [BR:gyc03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     GYMC61_0956
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 HHH_5 Viral_helicase1 AAA_11 Zeta_toxin UvrD-helicase UvrD_C T2SSE AAA_16 AAA_12 NTPase_1 HTH_IclR AAA_22 AAA AAA_28 AAA_23 TsaE AAA_29 AAA_18 HHH_3
Motif
Other DBs
NCBI-ProteinID: ACX77622
Position
957434..959794
Genome map
AA seq 786 aa AA seqDB search
MQEQQILALDGRTFIKGVCLAVIFHNEETLYTVVRVRVEETNEAPVEEEVVVTGYFPRLN
EGDVYIFYGQFRQHPRFGRQYAASQFRKQLPNTKEGVIHYLSSGLFKGIGKKTAAAIVET
LGENAIAAILRDPKALERVPKLTKKKAKQLYDALRAHEGLEQTMIALAQLGFGPQLAMKI
YQAYGEEAIDIIHENPYQLVEDIEGIGFGRADEIGRQLGISGSHPARLRAASLFVLEQAC
LQEGHVYLREEELMERIGELLDGRLSGAVDGRAISQTLLMLSEEGKLIAEQGRYYLPSLY
FAEKGIVSNIKRLLGQTPPSAFAESEFLLALGALEERLGMQYAPQQREAIQQALSSPLFI
LTGGPGTGKTTVIKGIVELFAALNGLSIDPADYKQGEPFPVLLAAPTGRAAKRMSEATGL
PAATIHRLLGWNGAEGFSRDENEPISGKLLVIDEMSMVDTWLANQLLKAVPNGMQVIFVG
DEDQLPSVGPGQVLKDLLSSGVIPFARLTEVYRQAEGSSIIELAHKMKRGVVPDDLTAPK
ADRSFIRCRAGQVVDVVRQIADNARKKGFSVKDIQVLAPMYRGPAGIDQLNKALQELFNP
PAEGKRELSVGEVVYRVGDKVLQLVNQPEDNVFNGDIGEIVAIFYAKENIEKQDLLVVSF
DGIEVTYTRQDLGQITHAYCCSVHKAQGSEFPIVILPVVKNYYRMLKRNLLYTAVTRSKQ
FLVLCGEEEAFRFGVAKQSDGARQTALAEKLAGAAAPFVEVELPFEEANMGMENVTPYDF
MGDEPS
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
ttgcaagagcaacaaatcctcgcccttgacggacgcacgttcattaaaggagtgtgcttg
gcggtcatttttcataatgaggaaacattgtacacggtcgtccgcgtgcgcgttgaggaa
acgaacgaagcgcccgttgaggaggaagtcgtcgtcaccggctattttccgcgtttaaac
gaaggggacgtctacatcttttacggacaattccgccaacatccgcgttttggccgccaa
tatgcggctagtcagttccgcaaacagcttccgaacacgaaagaaggagtcattcattat
ttatcgagcggtttgtttaaaggaatcggcaaaaaaacggctgcggcgattgtcgagacg
ctcggcgaaaacgcgatcgccgcgattttgcgcgaccccaaggcgctagagcgtgtgccg
aagctgacgaaaaaaaaggcgaagcagctgtacgatgcgcttcgcgcccacgaagggctt
gagcaaacgatgatcgccctcgcccagctcggttttggcccgcagctggccatgaaaatt
taccaagcgtatggcgaagaagcgattgacatcatccacgagaacccgtaccagctcgtt
gaggatatcgaagggatcggctttggccgcgctgatgaaatcgggcgccagctcggcatt
tccggcagccatccggcccggctgcgcgccgcctcgttgtttgttcttgaacaggcgtgc
ttgcaggaagggcacgtttatttgcgcgaggaagagctgatggagcgcatcggggagctg
cttgacggaaggctgagcggtgcggtggatggacgagcgatcagccaaacgcttctgatg
ttaagcgaggaagggaagctgatcgccgagcaagggcgttattatctcccttccctttac
ttcgccgagaaagggatcgtctccaacattaagcggctgctcgggcagacgccgccgtcg
gcgtttgccgagtcggagtttttgctggcgcttggggcgcttgaggaacggcttggcatg
caatatgccccccagcaaagggaagcgatccaacaagcgctttcttcgccgctgtttatt
ttgaccggcggtccgggaacggggaaaacgacggtcatcaaaggcatcgtcgagctgttt
gccgccctaaacggcctgtctattgacccggctgactacaaacaaggcgagccgtttccg
gtgctgctggccgcaccgaccggccgagcggcgaagcggatgagcgaggcgaccgggctg
ccggcggcgacgatccaccgcttgctcggctggaatggggcggaagggttcagccgcgac
gagaacgaaccgatttccggcaagctgcttgtcatcgatgagatgtcgatggtcgacacg
tggctcgccaaccagctgttaaaagccgtgccaaacggcatgcaagtcattttcgtcggc
gatgaggatcaattgccatccgtggggccagggcaagtgctgaaagacttgctctcttca
ggcgtcattccgttcgctcggttgaccgaggtgtatcgccaggcggaaggatcatcgatc
atcgagcttgctcataagatgaagcgcggcgtcgtgccggacgatttgaccgctccgaag
gcagaccgttccttcatccgctgccgtgcgggccaggtcgtcgatgtcgtgcggcaaatc
gcggacaacgcgcgcaaaaaagggttttccgtcaaagatattcaagtgctcgccccgatg
taccgtggtccagcgggcattgaccaattgaacaaggcgcttcaagagctgttcaacccg
ccggctgaggggaagcgggagctgtcggtcggtgaggtcgtctaccgcgtcggcgataag
gtgctgcagctcgtcaatcaaccggaagacaatgtgtttaacggcgacatcggcgaaatc
gttgccattttttacgccaaagaaaatatcgaaaagcaagacttgctcgtcgtctcgttt
gatggcattgaagtgacgtacacacggcaagatttaggacaaatcacccatgcgtactgc
tgttcggttcataaggcgcaaggaagcgagtttccaatcgtcattttgcccgtcgtcaaa
aactattaccggatgttgaaacggaatttgttgtatactgcggtgacaagaagcaagcag
tttctcgttttatgcggggaagaggaagcgtttcgattcggcgtcgcaaaacaaagcgac
ggagcgcgccagacggcgctcgctgagaagctggcgggggcggcggcgccgtttgtcgag
gtcgaactgccgtttgaagaggcgaacatggggatggaaaacgttacgccgtatgacttt
atgggcgatgagccaagctaa

DBGET integrated database retrieval system