KEGG   Geobacillus sp. Y412MC61: GYMC61_1480Help
Entry
GYMC61_1480       CDS       T01101                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
gyc  Geobacillus sp. Y412MC61
Pathway
gyc00630  Glyoxylate and dicarboxylate metabolism
gyc01100  Metabolic pathways
gyc01110  Biosynthesis of secondary metabolites
gyc01120  Microbial metabolism in diverse environments
gyc01200  Carbon metabolism
Module
gyc_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:gyc00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    GYMC61_1480
Enzymes [BR:gyc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     GYMC61_1480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ACX78120
Position
1505333..1506619
Genome map
AA seq 428 aa AA seqDB search
MASFAERVRQLEESWKNEERWEGIVRPYSAEDVIKLRGSLDIEYTLARRGAEKLWKLLHT
EDYVAALGALTGNQAVQQVKAGLKAIYLSGWQVAADANLAGQMYPDQSLYPSNSVPHVVK
RINQALQRADQIQYLEGSGDVDYFVPIVADAEAGFGGQLNVFELMKAMIEAGAAGVHFED
QLSSEKKCGHLGGKVLLPTQTAIRNLIAARLAADVMGVPTVLIARTDANAADLITSDIDP
RDQAFITGERTPEGFYRTRAGLDQAIARGLAYAPYADLIWCETSEPNLDEARRFAEAIHE
KFPGKLLAYNCSPSFNWKKKLDDETIAKFQQELGKMGYKFQFVTLAGFHALNYSMFELAR
GYKERGMAAYAELQQAEFAAEKYGYTATRHQREVGTGYFDEVAQVISGGQSSTVALKGST
EEEQFTTA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcatttgctgaacgtgtccggcaattagaagaaagttggaaaaacgaggagcgc
tgggaagggatcgtccgtccgtacagcgcggaggatgtcattaaactgcgcggctcgctt
gacatcgagtatacgctcgctcgacgcggggcggaaaaattatggaagctgcttcataca
gaggattacgtcgcggcccttggcgcgctgaccggaaatcaggcggtgcagcaagtgaaa
gcaggcttgaaggcgatttatttaagcggctggcaagtggcggccgacgccaacctcgct
ggacagatgtatccggaccaaagcctgtatccgtccaacagcgttccgcatgtcgtcaag
cgaatcaatcaagcgttgcagcgcgcggatcaaattcaatacttagaaggcagcggggac
gtggactactttgtgccgatcgtcgctgacgccgaggcgggattcggcggccaactgaac
gtctttgagctcatgaaggcgatgattgaggccggagcggctggcgtccattttgaagac
cagctgtcatcggagaaaaaatgcggccatttaggcggcaaagtgcttttgccgacgcaa
acggcgattcgcaacttgatcgcggcgcggttggccgccgatgtcatgggggttccgacg
gtgctcatcgcacgcaccgacgcgaacgctgctgacttgatcacaagcgacatcgacccg
cgcgatcaagcgtttatcaccggggaacggactccggaagggttttatcgcacaagagcc
ggtttggatcaagcgatcgcccgcgggcttgcctatgcgccatatgccgacctcatttgg
tgcgagacgagcgagccgaatttggatgaggcgcgccgatttgccgaagccatccatgag
aaattcccaggcaagctgctggcgtacaactgctcgccgtcgttcaactggaagaaaaaa
ttggacgacgaaacgatcgccaaattccagcaagagctcggcaaaatgggatacaagttc
caatttgtcaccttggctggcttccatgcgctcaactacagcatgttcgaactggcgcgc
ggctacaaagagcgaggcatggcggcgtacgccgagctgcagcaagcggaatttgccgcc
gagaagtacggctacacggcgacgcgccatcagcgcgaagtcggcacgggctatttcgac
gaagtcgcccaagtgatctctggcggccaatcgtcaacagtcgctttgaaaggatcgacc
gaagaagaacagtttacgacagcttaa

DBGET integrated database retrieval system